SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppb015337m|PACid:17644827 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppb015337m|PACid:17644827
Domain Number 1 Region: 73-152,191-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000419
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppb015337m|PACid:17644827
Sequence length 295
Sequence
MAFVLPHLLFLLFLLFLLLPFSVIAQTNGNISVGSTLTAGEESAWWLSPSNDFALGFQKL
DNDHFLLAIWCHKIPQKTIVWYANEGNPSLRKSEVELTDQGLLLRPPQGDQQLLTEFPAA
AIAYGVMNDMGNFMIVDTSFRVIWETFNHPTDTLLPDGHILYYIFNLILSKYAYDAYYIS
SSRDEANDTNSCYKVIFDQSGYLYILRRSGERFFITTPGQALSHTRYYVRATLHFDGVFI
ISYQPKNSTTSESWSVIHTEPDNICVKIAGELGTGPCGYNSVCTLKEDRRPSCRC
Download sequence
Identical sequences M5WMT7
ppb015337m|PACid:17644827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]