SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppb017003m|PACid:17649580 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppb017003m|PACid:17649580
Domain Number 1 Region: 202-272
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000013
Family alpha-D-mannose-specific plant lectins 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppb017003m|PACid:17649580
Sequence length 696
Sequence
AINAKREENKAELAKGGIVVVVVGVVRLSVNRSVRKIGLGGSLAARRALGGWAGILGGLG
LFSVPNPEDEAAETEENKSKLELIEKRNGCDFDFNLRPLRASMELKECEMLCMKNCSCTA
FANLDTRDGGSGCLLWFSELIDVRNFTENGQDIYFRMAASELDHEDYTTISAKPATPNFR
PGGSVFSNVWKKQHQIDEHYRSSNTSSSAQNPVAQLLDSGNLLVIDGNGYNDPDNILWQS
SDYPGDTLIPGMKLVRNKITDFNWHFTPWKSPQVPSQGRYAYQLGPYGYHELILREGSVK
KYLTAPWNGIQFSGMHNLNPTYDFVLDNDDEVYYGYKLLNSSTLFRLAYIGGDGNQGWVV
YLIATTDICDKYGICGPNGACSIDKSPVCSCLRGFILNFQQDWDLVDWSYSCVRKSQLNC
SGDIFKKYSGVKLPSTEQSWYNTKLSQKLALIVRWIIKSKDFFLYEFLTPQSSAFKYFIP
RSRKGHNTKIIVTSTVLSTGLLILGLTLLLLYVRKNQQQKYVSLTVSTCHLGQDYGYKSY
IERLQTKEYGFWPSYVANGFQGILKDGQEIAVKRLSKHSRQGLKIASGKRNRGFTHYLFL
FLLLIKHNGFELLINSFRHDRHQVSKFCIFFVNAKREENKAELAEGGIVAVVIGVVRPDL
CLLRLPNLNLKLKFEAKLFQFRVSDFQSIAMFEKSA
Download sequence
Identical sequences M5X978
ppb017003m|PACid:17649580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]