SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pmar_ATCC_18224:PMAA_065600.t1 from Penicillium marneffei ATCC 18224

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pmar_ATCC_18224:PMAA_065600.t1
Domain Number 1 Region: 405-514
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000827
Family UBX domain 0.019
Further Details:      
 
Domain Number 2 Region: 182-329
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000738
Family UAS domain 0.093
Further Details:      
 
Domain Number 3 Region: 14-58
Classification Level Classification E-value
Superfamily UBA-like 0.00000000204
Family TAP-C domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pmar_ATCC_18224:PMAA_065600.t1
Sequence length 535
Comment gene=PMAA_065600 NW_002196662:complement(join(1010975..1012441,1012503..1012643))
Sequence
MSSQDGGTDIGELSSTQQEALQTYMNVTGQEPDAAIPLLQRSQWNVQIAISKFFDGEGPD
PVEEARAALNAPQDIRRTQNLMYDIDDLPPRASSTSSSSRAAGLEPAPRIETQPEDQPAF
RPPFILSLLFSPLNLLYRLLYNSFRLFGTLFPFLPRWLNVTTGSSPLQRNLNTSGRRALA
PKDTAARFIREFEEEYGSHSLPFLENGYNMALEKAHQELKFLVVVLLSPEHDDMNGWVKE
TLLSRQVVEYINDPNNQILLWGGNVQDSEAYQVANSLRCTKFPFASVIVHTPNVGATAMS
NIGRIPGNTNPSEFLTKLRTAISQNKEPLDRVRARRAEQQASRTLRQEQDSAYERSLAQD
RERARQRREAEAARLRAEEEEAARLAVEEKRATDLKQWKQWRSQNLAREPEGPDAIRVSI
RLPSGERVIRKFAPDADLEEVYAFVECYEVLTAATDEDQEEQESEKPVSQPAGFEHKYGF
RLVSPMPRTIYEVEAGGSVKERIGRGGNLLVEMIEEEEDEDSEGEEGNVNNNESL
Download sequence
Identical sequences A0A093V6D2 B6QBH5
Pmar_ATCC_18224:PMAA_065600.t1 XP_002145998.1.75516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]