SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|15135|gw1.7.1257.1 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|15135|gw1.7.1257.1
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.01e-24
Family PDI-like 0.0014
Further Details:      
 
Domain Number 2 Region: 218-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 3e-22
Family PDI-like 0.0006
Further Details:      
 
Domain Number 3 Region: 338-456
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-21
Family PDI-like 0.001
Further Details:      
 
Domain Number 4 Region: 118-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000231
Family PDI-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|15135|gw1.7.1257.1
Sequence length 456
Sequence
AASSASDVISLTALSFETVVPSEALILVRFCTPWSSHCKALTPHYEQAATLLKAYNIKIA
DVDCVEEPDLCEVHQARGYPTLKIFRHGSQVTNYMGPRQADGIFSYMLDQSLPAVSEVTA
ANHAAFQQQAANNKKAVAIAYLSPTGPPADAFGAVARKLRDSSYLFGLSTDNDAIAAAGV
TPPAIVAYRSFDNPRTPCPLPVSRATAAELEEWITGLSVPLIAELGAENYHSYAISPKYL
ASLFLDPSDPQKEARLEAMRPVARKYKSRVNFVWIDAVEFREHARALNLKDAKWPAFVIQ
DFGRQQRKYALDQSVDVTPASVEDWVRQLLEGQLDPPLKSAPIPEAQDGPVFTLVGQQFD
EIVFDDSKDVFLALYTTWCGHCKHMHAAWDALGAYFAPFKDKITIAKMEMAANELPASVP
FRVAGFPTIKFKRAGTRTFIDYARPRTLEDFVAFVE
Download sequence
Identical sequences jgi|PleosPC15_1|15135|gw1.7.1257.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]