SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|152816|genemark.681_g from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|152816|genemark.681_g
Domain Number 1 Region: 22-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000391
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 162-235
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000637
Family Glutathione S-transferase (GST), C-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|152816|genemark.681_g
Sequence length 245
Sequence
MANEREPEIVLYDLACTKNICFSPVVWIIRLMLNYKQVPYKTIFLEFPDIEPTLKGLGLL
SHDCTSKHKYTVPTIHHVRTNTYIMDSLRIAQFIEATYPDPPVPLTSELGSEIVAKARCA
LSPAFRTSLMPREINILSPRSQEYFRRTREASLGHPLEDLLVPEKEEQAWEAVADAMRAL
GELMLTNKAEGPFVLGASPSYTDFFITGSLQTAREIDEAVFQRCIKYPGFKEVYEACLPY
MEKRD
Download sequence
Identical sequences jgi|PleosPC15_1|152816|genemark.681_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]