SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|155293|genemark.3158_g from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|155293|genemark.3158_g
Domain Number 1 Region: 6-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000475
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|155293|genemark.3158_g
Sequence length 280
Sequence
MSQSSTPVLYTFGGSVWAAVPELALRELGYSSDTISKQTVNLVLGENFKPDFIKINPNAT
LPTLEADGKAYTSTTDVTAYLVQNAPKKVKAGNADFIKEIHEDSIDPNFALLLARNQEEL
AAKAAGLPGVFLSNRQDTLAKVAASIEGKEFEEFYADKIAGNGGLLDIYRGNALEATKDG
FFQQSQDHFANVGAYILKSLPQRLPQATAFLGGDIPGEDDFHLGAWLARIAATVGAIKSE
EGLTALKDAFGAEVPEQVAGYWKAWSSRDSWKDVYGEGLH
Download sequence
Identical sequences A0A067P408
jgi|PleosPC15_1|155293|genemark.3158_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]