SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|156996|genemark.4861_g from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|156996|genemark.4861_g
Domain Number 1 Region: 102-218
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.05e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.00067
Further Details:      
 
Domain Number 2 Region: 7-93
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.47e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|156996|genemark.4861_g
Sequence length 221
Sequence
MPDAKKPLLLYTAPTPNGHKVSVFLEELKAAYGIDYDVEKIDISKNVQKEPWFIKLNPNG
RIPVLVDRSRNDFPVFETAAIILYLQHHYDKDGKFGWTAEKDPDFWSEELQWIFFTHGGV
GPMQGQANHFNRAAPEKIPYAINRYIEETKRLYGVLEIRLTGRDWLVGPGKGQYSIADIN
VIPWIRVHSYAGIENLDQWPSVKAWVERATARPTFQAGIKV
Download sequence
Identical sequences A0A067NMV9
jgi|PleosPC15_1|156996|genemark.4861_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]