SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|156997|genemark.4862_g from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|156997|genemark.4862_g
Domain Number 1 Region: 22-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000215
Family Glutathione S-transferase (GST), N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 164-218
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000199
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|156997|genemark.4862_g
Sequence length 251
Sequence
MSQKLITFYDITTKAKPNPGPSPFTAKVRCALNLKGIKFTTVWLEYPEIEAECKRIGAPP
TGKRPDGSLLYTLPVIQDLSTGVVMSESNVILEYLDKTYPDTPKLFPGNTLGIQLAFDAA
AQTRLLDILPLVIAYIPAGLNPVAEAHWRSTRERQLGKRVEELEPKGEARVAALQKTQAS
LGEVDGWISKSGEGKFIMGDEMTFVDISLGAALCGVRVALGDKGAAFWEEISGWQSGRWE
QLRKACEPYHK
Download sequence
Identical sequences A0A067NYQ2
jgi|PleosPC15_1|156997|genemark.4862_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]