SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|159561|genemark.7426_g from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|159561|genemark.7426_g
Domain Number 1 Region: 10-201,301-393
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.14e-58
Family FAD-linked reductases, N-terminal domain 0.0000296
Further Details:      
 
Domain Number 2 Region: 432-604
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.25e-36
Family Glutathione peroxidase-like 0.00028
Further Details:      
 
Domain Number 3 Region: 204-307
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.65e-27
Family PHBH-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|159561|genemark.7426_g
Sequence length 605
Sequence
MPTSLVKESDVDVLVIGAGPAGLMCANGLAKAGIKVRIVDQRPGDLLAGRADGLQPRTLE
VLQSYGLAERVFKEANQMHMAAFYNPSPNGGIELTDRAPDVTAPTARYPFECTLHQGAIE
AIFHDSMRSMGVQVDRPTIPESIQISQDGDVLKDPEAYPVRVVLKHLRTADGEIDTEVVH
AKFVVGADGAHSWVRKSLGIQMEGEQTDFVWGVVDLVPDTDFPDIRNRCAIHSNNGSCMI
IPREGDKVRLYIQLGHTDAVDSTNGRVDMSKTSPYKLMEVAKTSLQPFYIRNTGDIDWWT
IYIIGQRVASRFSVNNRVFIAGDACHTHSPKAGQGMNASMNDTHNLVWKLTYVLRGWADM
SLLDTYEFERRKYAQDLINFDKKFSALFSGKPRTQEYQDGVSHEEFKKAFQTFGGFTSGI
GIRYAESLITNCKYQDYASNLKIGRRMPPQVLLRAADSRPVELQDLLPSDTRFKFLLFTG
DISSPSQQGKLSELSQRLGRPEGLLDPTLVGSRRSMLEVLTIGVGSKWTVRYTDIPPLFR
SHWSKVLIDDADPHERSGGKAYTSFGINPSGAIVIVRPDGYVGMVAPFTAVDDIEQYFDS
FAVKE
Download sequence
Identical sequences jgi|PleosPC15_1|159561|genemark.7426_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]