SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|159729|genemark.7594_g from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|159729|genemark.7594_g
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.8e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 88-234
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.27e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|159729|genemark.7594_g
Sequence length 239
Sequence
MPETLTLYTAKICPYAHRTELALEEAHADYTRYEIDLSNKPEWYAPRVNPASKVPAIAYG
GPKTAPDQPSPESEKIAESLVLLEFIADLYPDSNLLPKDPVLRAKARFFIDAFSTKVSPF
YMAFVARGEPFENLLKGIEALQSLLPPEGKGPFALGSQFSIADAAVLPFIARLYVILKND
IGGFAKGVGPASFKILQEDEKYKRFKSYVEALFERESFKKTFHEDVIAEVYQKRFGRQE
Download sequence
Identical sequences A0A067NRW7
jgi|PleosPC15_1|159729|genemark.7594_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]