SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|160780|genemark.8645_g from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|160780|genemark.8645_g
Domain Number 1 Region: 257-377
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-20
Family PDI-like 0.0027
Further Details:      
 
Domain Number 2 Region: 56-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000101
Family PDI-like 0.011
Further Details:      
 
Domain Number 3 Region: 153-214
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000116
Family PDI-like 0.0036
Further Details:      
 
Domain Number 4 Region: 10-54
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000282
Family PDI-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|160780|genemark.8645_g
Sequence length 404
Sequence
MGERWFTSLVRGYPTLKVFRHGSWVRDYTGPHQAEGIISYMLAQSLPAVSKVTAENHQEF
QEQAGDSTKVVVIAYLTSPTEAPADAFIAVAESHRGRNHVFGLTTDSDAIHAAGVTPPAI
VAYRSFDDPMTEYPLPVSGATAAELEEWISDLSTPLINELSAENYATYANSPKPLAYLFL
NPSDERKDAHIESMRPIAQKYKSELNFAWMDAVPVGFGDHTGALDFEHAECREFVTSASA
EGWLQQLLEGGLPEPKSAPIPETQEELVFTLVARQFDEVVFDDAKDVFLELYTTQCEECE
RMKPAWDALAEEYAPLKDTVTIAKMDMQANDLPPSAPFAVTGFPTIVFKPAGTRTFIDYD
EDRTLEEFIVFVEMYTGNGVGVPEEEPVVSGGGDVARVLLGAGI
Download sequence
Identical sequences A0A067NEA9
jgi|PleosPC15_1|160780|genemark.8645_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]