SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|162059|genemark.9924_g from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|162059|genemark.9924_g
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000464
Family Glutathione S-transferase (GST), N-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|162059|genemark.9924_g
Sequence length 71
Sequence
MSSAGTIWTIPQQAKGKLVRAVATFAGINFELPASYTHFETNKQPEFLAKFPHGKIPAWE
GADGFFWSLGG
Download sequence
Identical sequences A0A067NK31
jgi|PleosPC15_1|162059|genemark.9924_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]