SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|162839|genemark.10704_g from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|162839|genemark.10704_g
Domain Number 1 Region: 4-166,261-347
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.83e-46
Family FAD-linked reductases, N-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 396-527
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000649
Family Glutathione peroxidase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|162839|genemark.10704_g
Sequence length 531
Sequence
MNHSVLIVGAGPTGLILAITLALNGVHARVIERDTARKIGQRASDILSSSSQIPQMAAYP
IGGNVPIKTMDMLSDAAEPSDAFPTTRAVMLGQEKQVEVLTAHLLKLGGVVERGIELVSF
EQSSEHVFAVLKRSGDEEVTEERAIFDYLVGTDGAHSQTRKQLGLSFLGETRKAQQMIIG
DVYLRGSLTHDQPLWRIWGDMSSSFLALRPVVETPGLFFLFIGGPEASQSILSDHEELVC
YLRRTSGRPDLDCDKPTWLSPYTPNVRMVDSFRKDRVFVAGDAAHVHSPAGGQGSNSGAQ
DAFNLGWKLALVVKGLARPPLLDSYNAERLPVIAEMLQLTSALHDKTFKAGLDDQAWKRG
SHLDQLGVNYRGTPFVLDEIEGRPPSTSNCYDSRPSGVLMAGDRAPDASSLIPSRGVLTG
DRLFDIFNATRHTILVFTRQESDPQASLVVQLLKAYPSGLFKSVAVLPSDSTTSLDVGFD
LVVKDGQGNGYAAYKIPSDSTVIVVVRPDGVIGAMLTNCDGLHRYLDIISF
Download sequence
Identical sequences jgi|PleosPC15_1|162839|genemark.10704_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]