SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|164120|fgenesh2_pg.1_#_226 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|164120|fgenesh2_pg.1_#_226
Domain Number 1 Region: 20-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000016
Family Glutathione S-transferase (GST), N-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 162-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000835
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|164120|fgenesh2_pg.1_#_226
Sequence length 246
Sequence
MAQPGIIFYDIPSSSVIGHQPWSPNTWRVRYALNIKGIPFQTVWVEYPDIEDVCKKIGAA
PTSPIAPHYTLPVIQDTSTGAVVSDGPLIVEYLDKQYPNTPTLFPSGTIALQYAFVDAHI
AAISPIFPFSIPRVNEIINPHSEPYFRRTREASFGKKIEEITPVGEAYTEGWEKYKDGLG
KVDGWFKKSGGPFITGDSITFADVTVASWMVCLKIIYGENSQQWRDIASWHDGRWDGLVN
AFAKYQ
Download sequence
Identical sequences jgi|PleosPC15_1|164120|fgenesh2_pg.1_#_226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]