SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|165849|fgenesh2_pg.3_#_238 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|165849|fgenesh2_pg.3_#_238
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000394
Family Glutathione S-transferase (GST), N-terminal domain 0.0055
Further Details:      
 
Domain Number 2 Region: 84-224
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000136
Family Glutathione S-transferase (GST), C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|165849|fgenesh2_pg.3_#_238
Sequence length 237
Sequence
MCLSSVYASPYGHYVEIALQEARAEYSRFEVQIPNKPSWFTEKVNPAGKVPAITYGGPTT
PADDPSPNSHKLAESLVILEFIADIFPDSGLLPSDPLLRASVRFFINLVLTKLHPAHLNA
MINRGSPDHILSAIDQLQPYMPGGSLNDTKGPFIAGNTFGNADAVAAAYFIRLDGCLKRD
IGSFPEGEGVKAYNVLHTSEQYAQYRAYLSALAGRESVKETYPEMFYGADMSASLTI
Download sequence
Identical sequences jgi|PleosPC15_1|165849|fgenesh2_pg.3_#_238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]