SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|168246|fgenesh2_pg.5_#_549 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|168246|fgenesh2_pg.5_#_549
Domain Number 1 Region: 164-248
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000267
Family Glutathione peroxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|168246|fgenesh2_pg.5_#_549
Sequence length 395
Sequence
MISLKSVSAAPTNVPYIIDLTTQEFRPTKATRQRKPVTPQRTKSPKATNADHLVTPTSNL
QIFTIDAPRKVPQITVRRKPVSPASVERPGSGLDLTLSETSAPPVPPPDSFARYMSAFAD
QSMHVQFNIPRNRPLSRPGTSRSFRAPRDLDVPSRSQLQQAALLSVVGQRGERISFGELF
QKQKTLVIFIRHFCVSPEMLKRAGVKLVIISNGSHKMIRSYRKIFRTPFQVYTDPTHRVY
DALGMTTEVADEFTAPGGYVRHGVFSGIAMVVANALKVGMPVWERGGDISRLGGEFILGP
GITCSFAHRMQNPRSHAPIMRLIAEVGVDVATPEARSPSPASKPPNMTEEEEMQWMKGRR
RSLAALKARKVQRRGGSQWCGGSNCLINVDSKEST
Download sequence
Identical sequences jgi|PleosPC15_1|168246|fgenesh2_pg.5_#_549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]