SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|171577|fgenesh2_pg.11_#_26 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|171577|fgenesh2_pg.11_#_26
Domain Number 1 Region: 5-145,179-203,299-384
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.28e-48
Family FAD-linked reductases, N-terminal domain 0.00068
Further Details:      
 
Domain Number 2 Region: 413-561
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.57e-20
Family Glutathione peroxidase-like 0.0015
Further Details:      
 
Domain Number 3 Region: 202-305
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.49e-19
Family PHBH-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|171577|fgenesh2_pg.11_#_26
Sequence length 564
Sequence
MNNTNFDVLVIGMGPAGLMCALSLAKAGVRTKIIDRRALGTQYGNADGIQPRTLEIWDTY
GILKRFVDGSAPMHAMVTYNPEIDNGQLKLVRTRPVRNVVVDSRFPYERTAAIEHIEGTL
REALLEAGGAVQYSTTPTNVEVTPESQSEYPIRVALETVSVPLDKRGHGGDLHQTSSSET
IQAKYLVGADGANSWASLNAILESIWGVTDVIVETNFSDCRMKCIINAPTGTIITIPREG
EKIRFYVQLSLDDCQLTPSGRVDKSHLSSEASRRMVLKRIQAGMSPFEVKFTHVFWCTIF
AIPQRVAKRFSVQDRVFIVGDACHQHSPKAGQGANAAMGDSHNLAWKLAHVIKGWATPNI
LRTYEIERKGYAQQLINFDKEISETLEAGSPDSYESGLGIRYDSMLTIQSSVSQQGERAI
TVGKYLPWCPVTRLADWDSMDIQSLISFDGLWRLLIFPGDIRSENNQAELARLEKEVGRC
VGVLKHAILYTILDNREDEAQWTDVPRVLRSWKRDRRSSPNVYELLGTDQLGSIVLVRPD
GYVSMVQELAGFNGDELTRFFLAL
Download sequence
Identical sequences jgi|PleosPC15_1|171577|fgenesh2_pg.11_#_26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]