SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|172047|fgenesh2_pg.12_#_157 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|172047|fgenesh2_pg.12_#_157
Domain Number 1 Region: 54-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.4e-20
Family Glutathione peroxidase-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|172047|fgenesh2_pg.12_#_157
Sequence length 179
Sequence
MTSIITGTAQAAHSALASLLANAQIKPGESIPEDIKVKENDAMAAEAFKLVGTNVIVGVP
GAFTGTCSAQVPKYIQSLEKFKEKGVNNVFVVAANDVFVMKAWKEQLAASGTGVRFIADD
KGELVSRLGLIFDASPLLGSPRAKRFVLITDGPVVRTVAVEEDPSQVTITAADVILAQL
Download sequence
Identical sequences A0A067NF75
jgi|PleosPC15_1|172047|fgenesh2_pg.12_#_157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]