SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|173261|estExt_genemark.C_31587 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|173261|estExt_genemark.C_31587
Domain Number 1 Region: 30-124
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.92e-28
Family Thioltransferase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|173261|estExt_genemark.C_31587
Sequence length 125
Sequence
MSFLFSLFSSSASSSNSSSAQRQLMSAKSLVEDAIAGHTVAIFSKSYCPYCKRAKQLFAS
NYADVDTIIYELDDRDDGAQIQDYLAEKTGQRTVPNIFVNQKHVGGSSDVAALQDKGELK
ALITA
Download sequence
Identical sequences jgi|PleosPC15_1|173261|estExt_genemark.C_31587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]