SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|173322|estExt_genemark.C_40277 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|173322|estExt_genemark.C_40277
Domain Number 1 Region: 390-458
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000275
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0045
Further Details:      
 
Domain Number 2 Region: 867-892
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000615
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|173322|estExt_genemark.C_40277
Sequence length 899
Sequence
MDSMYQWIQAQHPQQQQQQAPMLQETSSAHNPLHEQQRPPSTSMGESGASNGAPNSAAEA
PQPIEIDDYGSLGLGAPASYSSSFGASQPSSATATSFSHSPYPSHPGFFYSAAPFNTIAY
GSSWGSLPISSFSTLNGANPGATIPSSSQQQQQQPQQQQRSQQPMHTSQSPPMVIDPALT
NGASSSTLTYSQPSASVPSSQSPSQLQQQQQQQQLQQRASAYLQAYNLHPYLQHYAQQLQ
NHTQSQGTLSPQVLQSPSISNPQSSLTAANFYAPSPPISSSTSGSSTSTSATIVPPAPTP
QERKQQFQAVLKPLLVSSAFTGAQAVNSLMDHIEDYGPTNVDHDVRLEILTKIRDGAGNH
YFRAWAENPFAMDVTRKWLWSAISAAKTGDPLSETTMPLLHLLDRLPLTVELLKTSKLGK
VIVKISKEDFSAAIKDMASNIERRWRLLISPPDAAKPPENIKSEDFKVKKRKLSEPPSSK
SVPPQKKPATGTSSSVKPMVKKEVKPAVSAVKDAKSDSSFFSAPKPKPKLPSFKKAPPAA
VVKKEPDTNVAQPSSIDPFQEALKFMAKGRKESPSTQTPPPASATPVDTPLQPLNSSKST
KKRKSVTWAPDGQLENIRLIEKAIYDDDPVDGAHVLHSNLRELERGEGAALHTHIFEETV
DWSEPILIDFSSTIVPPLRGQESEEREVQEKREQTVLGAVYMAPQHIPDTPGEPSQVLPE
EEVIKDMATMTCGPEADAIFWAPEPEVPPTSTVSDLLGQISSGVGMDYSQPPENGGGAEL
GGAQFNFEQIAAIAQQMPQLQSLLQQLGNNQPAQPYGNVDQAWNNTYSEFGQGYHDEDTR
DQWPSERGRGRGRGRGRGRGEDGGHRHNKKRICSFYAAGRCRYGDQCDFIHETPNGTMY
Download sequence
Identical sequences A0A067NL81
jgi|PleosPC15_1|173322|estExt_genemark.C_40277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]