SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|174701|estExt_genemark.C_90540 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|174701|estExt_genemark.C_90540
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.02e-17
Family ArsC-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|174701|estExt_genemark.C_90540
Sequence length 156
Sequence
MFSGFKRVLPEISIFHNPASPPSTKALTLLRASLSSPYPAGKADAPPLHFNLEVIESPPT
SDQLRTITSFLPKSSPSLFLSAHPSTASETPNISEIVGLAKKNPNTFKWPVVVDWAAGKA
SVGDVEGVKEILENLRKQRDGEAKGEEVDQPKGWFS
Download sequence
Identical sequences A0A067N6M5
jgi|PleosPC15_1|174701|estExt_genemark.C_90540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]