SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|186063|fgenesh3_kg.7_#_23_#_2007_1_CCFG_CCFH from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|186063|fgenesh3_kg.7_#_23_#_2007_1_CCFG_CCFH
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-31
Family Thioltransferase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|186063|fgenesh3_kg.7_#_23_#_2007_1_CCFG_CCFH
Sequence length 108
Sequence
MVVKALTTLPAFRQAINGSRPALVDFWATWCGPCRVISPVFEKFSTTTSKVDFYKVDVDE
CPDIAQEVGIRAMPTFMAFKKGSNIGTVVGADPTALKTLIERSSSQSD
Download sequence
Identical sequences A0A067NQ75
jgi|PleosPC15_1|186063|fgenesh3_kg.7_#_23_#_2007_1_CCFG_CCFH

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]