SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|186189|fgenesh3_kg.12_#_4_#_1695_1_CCFG_CCFH from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|186189|fgenesh3_kg.12_#_4_#_1695_1_CCFG_CCFH
Domain Number 1 Region: 8-212
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.54e-69
Family Glutathione peroxidase-like 0.000000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|186189|fgenesh3_kg.12_#_4_#_1695_1_CCFG_CCFH
Sequence length 222
Sequence
MAAAHKSLRLGDIAPDFEAETTAGPIKFHDWIGDSWAVLFSHPGDFTPVCTTELGEVARR
APDFAARNVKVIGISANGLEEHHKWVQDINDFGSKTAPTDVQFPIIADADRKISTLYDML
DYQDATNKDAKGLPFTIRTVFVIDPKKVIRLTLAYPASTGRNFDEILRVIDSLQLGDKHR
ITTPVNWKKGDDVIVHPSVTNEEAKTLFPEHTVHKVRTCAPL
Download sequence
Identical sequences jgi|PleosPC15_1|186189|fgenesh3_kg.12_#_4_#_1695_1_CCFG_CCFH

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]