SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|27781|e_gw1.4.1517.1 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|27781|e_gw1.4.1517.1
Domain Number 1 Region: 10-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-34
Family PDI-like 0.00072
Further Details:      
 
Domain Number 2 Region: 338-463
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.71e-28
Family PDI-like 0.00096
Further Details:      
 
Domain Number 3 Region: 220-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.21e-23
Family PDI-like 0.00041
Further Details:      
 
Domain Number 4 Region: 125-221
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000981
Family PDI-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|27781|e_gw1.4.1517.1
Sequence length 503
Sequence
MLASLVAAEAASDVISLTAGSFESVVNPEPLILVEFFAPWCGHCKALAPHYEEAATALKE
KNIKIAKVDCVEEPDLCQAHEVQGYPTLKVFRNGSANDYTGPRKADGIISYMVKQSLPAV
SDVTAANHEEFQKADKVVAIAYLASSTEAPAVEFSAAAEKHRDDYLFGLSTDKDAIAAAG
VKPPAVVVYRSFDEPKTEYPLPVSAVTTAELEEWIADLAVPVIDEVSGENYAVYANSPKP
LAYLFLDPSDEKKQAYIEAIRPVAQKYKAKVNFVWIDAIKFGDHAKALNIMDTKWPAFVV
QDLKQQLKYPLDQSKDVTPEAAGEWVQQYLDGKLEPALKSAPIPETQDEPVFTLVGKQFD
EIVFDDSKDVFLELYATWCGHCKRLKPIWDSLGEKYAPLKEKITIAKMEAQENDLPPSVP
FRVAGFPTIKFKPAGTREFIDYDGDRTLESLVAFVEEHAKNSLELPKAEPVVPVEDAAQT
PLAAETPVATPAASATPEAHDEL
Download sequence
Identical sequences jgi|PleosPC15_1|27781|e_gw1.4.1517.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]