SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|35037|e_gw1.10.293.1 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|35037|e_gw1.10.293.1
Domain Number 1 Region: 140-220
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000157
Family Thioredoxin-like 2Fe-2S ferredoxin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|35037|e_gw1.10.293.1
Sequence length 261
Sequence
MFTWRRLPARLANAVAGARHNSQLSVVPELVGTAPWHQYIVFLRTTMRPSEYPSRMTSQL
QRHLQLRVRESGGLVNFSWFPEKSSLTNLRDPLAYEATAFFQSGSSFSYPEVNMSNVDGV
AASLEAHAREQSPKATSNHTHIYVCTHAARDCRCGTAGGEVAAALREEVKSRSETERIFV
SETAHVGGHKYAANVLVYPHGDWLGLVTPDLVPNLLDAIMDHSKLPVSPNTTPLLYHHWR
GRMGLDKDQQLELYQRTTAQH
Download sequence
Identical sequences jgi|PleosPC15_1|35037|e_gw1.10.293.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]