SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|40894|estExt_Genewise1Plus.C_70880 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|40894|estExt_Genewise1Plus.C_70880
Domain Number 1 Region: 21-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000299
Family Glutathione S-transferase (GST), N-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|40894|estExt_Genewise1Plus.C_70880
Sequence length 254
Sequence
MTTTTTITFYDIYANVEPVPTMSPSTLRVRYALNLKGIAFETVWIEFPHIEQVCQGLGVA
PTGKSRDGKPRYTLPAIKDVSTGIALSDGAEIIEYLDKAYPNTPTLLPRDTIALQLATYS
ALVPRFLAIYPLYAARAVRLFNPGTQRWWRETRAVLFGKSLEEAEPRGEEKTKALNKFIA
NFGEVYQWMSRGDGSFSTGDRTVSFVELTLAGMLNSLKIVFGEDSEEWQKIASWNNASWL
PFLAKYEQYHKAAG
Download sequence
Identical sequences jgi|PleosPC15_1|40894|estExt_Genewise1Plus.C_70880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]