SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|41036|estExt_Genewise1Plus.C_71412 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|41036|estExt_Genewise1Plus.C_71412
Domain Number 1 Region: 24-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.04e-27
Family PDI-like 0.0016
Further Details:      
 
Domain Number 2 Region: 341-459
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.22e-19
Family PDI-like 0.0024
Further Details:      
 
Domain Number 3 Region: 141-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000143
Family PDI-like 0.0097
Further Details:      
 
Domain Number 4 Region: 238-349
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000296
Family PDI-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|41036|estExt_Genewise1Plus.C_71412
Sequence length 486
Sequence
MHLRSLLSPGAALVLVSLAAVSSASDVTRLTALSFESIVPTEPLILVRFCAPWSSHCKAL
EPHYEQAATSLKANNIKLADVDCSEEADFCEAHKVQGYPTLKVFRHGSWVRDYTGPHHAE
GIISYMLEQSLPAVSKVTAENHQEFQEQAGDSTKVVVIAYLSSPTEAPADAFIAVAESHR
GRNHVFGLTTDSDAIDAAGVTPPAIVAYRSFDDPMTEYPLPVSDATAAELEEWISDLSIP
LIDELSAENYATYTNSPKPLAYLFLNPSDERKDAHIESMRPIAQKYKSEINFAWMDAVPV
GFGDHAGALDFEHAECREVTSESAEDWLQQLLEGELPEPKSAPIPETQDGLVFTLVAKQF
DEVVFDDSKDVFLELYTTQCEECERMKLAWDALAEEYAPLKDTITIAKMDMQENDLPASA
PFVVNGFPTIVFKPAGTRTFIDYDEDRSLEDFIVFVEVYTGNGVDIPEVEPVVPEEIEVA
QVPLGA
Download sequence
Identical sequences A0A067NQ13
jgi|PleosPC15_1|41036|estExt_Genewise1Plus.C_71412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]