SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|44072|estExt_Genewise1.C_32267 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|44072|estExt_Genewise1.C_32267
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.38e-33
Family Thioltransferase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|44072|estExt_Genewise1.C_32267
Sequence length 109
Sequence
MPVKVLSKFDEFQTIINSGEPVVIDFWATWCGPCRMISPILEQLSDNPDVSKVQFYKVDV
DEADEIAKDQQIKAMPTFRLYKDGKIVKELVGANPGALQGLVSEGALLV
Download sequence
Identical sequences A0A067NU68
jgi|PleosPC15_1|44072|estExt_Genewise1.C_32267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]