SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|48940|fgenesh1_pm.C_scaffold_2000133 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|48940|fgenesh1_pm.C_scaffold_2000133
Domain Number 1 Region: 152-287
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.29e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0096
Further Details:      
 
Domain Number 2 Region: 20-77,106-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000597
Family Glutathione S-transferase (GST), N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|48940|fgenesh1_pm.C_scaffold_2000133
Sequence length 305
Sequence
MKPEADGSFKRADASFRNVIEKGGRFEPEKDRYHLYVSYACPWATRTLIVRKLKGLEDFI
PVTVVSPRMGSQGWPFANVDNFEASDEDPLYKSEHVKDLYLKADPDYGGRFTVPVLWDKK
NHTIVNNESSEIIRIFNHAFDEFIPKDKAEIDYYPTELRNEIDELNSWIYPNVNNGVYRS
GFATTQESYSKAVKEVFEALDKLETILDGKDYLVGNRLTEADIRLWVTIIRFDPVYVGHF
KCNIRTIRGGYPNINTWLKKLYWNNEAFKVSTNFNHIKTHYYWSHTTINPTRIVPVGPFP
DIEPL
Download sequence
Identical sequences A0A067NVP5
jgi|PleosPC15_1|48940|fgenesh1_pm.C_scaffold_2000133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]