SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PleosPC15_1|51850|fgenesh1_pm.C_scaffold_7000119 from Pleurotus ostreatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PleosPC15_1|51850|fgenesh1_pm.C_scaffold_7000119
Domain Number 1 Region: 82-208
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.96e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.00056
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|PleosPC15_1|51850|fgenesh1_pm.C_scaffold_7000119
Sequence length 214
Sequence
MVLKLYGSPVSTCTKRVATVLIELNVPFELVPIDLRKGEQKTPQYLEKQPFGKVPYIDDD
GFILYESRAISRYLATKYSGQGTQLIPKDLQAWAKFEQAASVEICNFDPYASGVVIENYF
KPIFGQTPDEAQAKDLTEKLNANLDTYDLILSKQKFLGGDEFTLADLFHLPFGALLPPSG
VNALQERPNVNRWFDAISSRPSWQAVKDGVKSTA
Download sequence
Identical sequences A0A067NEU4
jgi|PleosPC15_1|51850|fgenesh1_pm.C_scaffold_7000119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]