SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|254572832|ref|XP_002493525.1| from Pichia pastoris GS115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254572832|ref|XP_002493525.1|
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily EF-hand 2.08e-22
Family Eps15 homology domain (EH domain) 0.0018
Further Details:      
 
Domain Number 2 Region: 127-226
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000442
Family Eps15 homology domain (EH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  gi|254572832|ref|XP_002493525.1|
Domain Number - Region: 330-391
Classification Level Classification E-value
Superfamily Tropomyosin 0.0288
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254572832|ref|XP_002493525.1|
Sequence length 393
Comment hypothetical protein [Pichia pastoris GS115]
Sequence
MPEKLEEWEIKKYWEIFSGLKPVDNKLSGDRVSVVFKNSQLNTDQLALIWDLSDIDQDGE
LDFEEFCIAMRLIFDLVNGTIAELPSTLPNWLVPGSKAHLVQANSAVSQGSNYSANTQVD
DDDEDAKLSSDFEWYISPADKSSYESIYTASSDQYGRIKFNDLQELYETLVKVPQTDISS
AWNLVNPKQAETIDKDQCLVFLHILNQRSNGKRVPRGVPASLRATFSKETPTYDLKSSQA
QVTKPSSAPGHESRKHSFADSYLSKIGASQNSSAEVGTDFSATKDTDWEEVRLTRQLQDL
EELISKVEKDRSQRLDPDPAVNASSMTKYELEQLLKYKEDKLTSLKSSNGASSGSLSSIK
ADVDLIESQVQTLQEYLQSKKEELKQLQSTLKT
Download sequence
Identical sequences C4R6X1 F2R070
XP_002493525.1.19831 644223.PAS_chr4_0920 gi|254572832|ref|XP_002493525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]