SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|254568888|ref|XP_002491554.1| from Pichia pastoris GS115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254568888|ref|XP_002491554.1|
Domain Number 1 Region: 125-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.51e-171
Family Calponin-homology domain, CH-domain 0.00000000000284
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily EF-hand 0.00000000299
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254568888|ref|XP_002491554.1|
Sequence length 629
Comment Fimbrin, actin-bundling protein [Pichia pastoris GS115]
Sequence
MSVLKLQKKYPVLTQEDLFQVIDDFRKIDLDDKGWADKQEVIESVSNAGHGSYDEIRETL
KTVSVDASGHVELEDFVELVSKLKESKVNPKQPTRTDTSDIFHRGAKASTKHVFKGASSG
STHTINDEERVEFTRHINSVLAGDPDIGDRLPFPTDSNQIFDECSDGLVLSKLINDSVPD
TIDTRVLNFPKGNKKLNNFTMSENANIVINSAKAIGCVVVNVHSEDIIDGREHLILGIIW
QIIRRGLLSKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWVNYHLKAAGTSRRISN
FSKDVSDGEAYTYLLNQLQPQHCDLSPLKTSDLLTRASQILDSADRIGVRKYLTPTSLVA
GNPKLNLAFVAHLFNTYPGLDPIEEEEKAEIEEFDAEGEREARVFTLWLNSLDVDPPIVN
LFEDLKDGTILLQAFDKVMPGSVSLNHVNKRKNGVELSRFKALENTNYAVEIGKANNFSL
VGIEGADIVDGTKTLTLGLVWQLMRRNINNTLSSLSVNGKEISDREILQWANAQVAKGGK
SSQIRSFKEPSLSSGIFLLDVLHGLKPGYVDYDLVTAGSTEEDRYANAKLAISIARKLGA
LIWLVPEDINEVRPRLILTFIGSLMALEL
Download sequence
Identical sequences C4R1A0 F2QSF8
gi|254568888|ref|XP_002491554.1| 644223.PAS_chr2-1_0631 XP_002491554.1.19831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]