SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|254571231|ref|XP_002492725.1| from Pichia pastoris GS115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254571231|ref|XP_002492725.1|
Domain Number 1 Region: 31-244
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.41e-19
Family BAR domain 0.024
Further Details:      
 
Domain Number 2 Region: 320-373
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-19
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254571231|ref|XP_002492725.1|
Sequence length 373
Comment Actin-associated protein [Pichia pastoris GS115]
Sequence
MKVDWNDVKENVIRAPQIFLQRTNLASTNPSLIDDEIIGLQTNFKNLVTNCKHLQVSLKR
YEESAKFMVECGLQTGQSLKSLVADTSKTRSEIDSLFLNKINQYNMVFQDCKPIVIEVLT
SLNDRVGSRLKQLESHNKEVASLLRQREYALLDLNKEMLCLERLKAKGNLMTCKEQQKIF
TTERKLTVCERNFTKLNRVIKQELPVYLVISKSIIENILQVIYFGTLTVFYELQNKLKSL
ERDINLHDADQSHYSTTTKNMELVSVFKAKHAPVALQVDSLKICHFYEKNLRNVASNIPS
ASTIVTNYSGLKIVQEDKDLVCVAGYNFEKINDQDLSFKRGDHIKVLKQEGSWWKGELNG
KVGNFPSNYVELI
Download sequence
Identical sequences C4R4R0
gi|254571231|ref|XP_002492725.1| XP_002492725.1.19831 644223.PAS_chr3_0498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]