SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00005T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00005T0
Domain Number 1 Region: 302-665
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-31
Family YicI catalytic domain-like 0.00079
Further Details:      
 
Domain Number 2 Region: 667-748
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000396
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 3 Region: 153-299
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000408
Family YicI N-terminal domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_00005T0
Sequence length 771
Comment | PTSG_00005 | Salpingoeca rosetta predicted protein (772 aa)
Sequence
MRPCCSLPSTWWLVVVVLAAACCAATPTAAAVPAAAPAEAADPSVVNVGQFVVSLDEDGV
LSAVRNPAQMPNPHLAWHSTGEILEVAASKMYLHGRDGMFETKDDAVVCSSNSFKFTSLV
GGSVGAIAKGLLMMGGDGCPSTQAIEATWNLNTADFDSNSLAVSVTLNDTRMCTQGQGVT
SCRFTLHSGVRPMDAVYGFGVQYSVWNMKGRVVPIIVSEQGVGRGLEPLTSLLDLVSFKQ
GGNWHTTYGAIPYYMTSNSTSFFLNHTEYSVFDLTAADTIVSTVYANSLNFVVSAENTPL
ALVSEFTFFTGRMRPLPDWILQGPIIGFYGGTDAVRALHSNITSLGIMNVTGYWLQDWTG
LRDTITGERLWWNWELDDQLYHGWSELVSDLAKDGTRLMTYVNPYLANTVTKHKKHFHRD
LFKEAAAQGFLVKNSKGDPYIDHSASPDFTFGTVDLSNPAAVNWFSNVIQHNMIEANHSG
WMSDFGEYLPFDAKLHTSDPSSFHNAFPLAWADTNRRALDAKNASDVVFFSRSSTFGSPA
RSTLFWLGDQLVTFDNFDGLQTVLIGRMTAGLCGHSLSHADVGGYTMVKELGVKYLRSKE
LLYRWMDVAAVIDVIFRSHQGNLPKDSWQVYSDTSALHCLARATRLHALFVPYRKYLMDV
AHGYGYPLVRALWLQYPAEPKVADITTQVMLGEDVLFAPALNADQSHVNVTFPPDVWTHV
WSGQVINATQVTTKPFKAPLGEPPIFFRSSSRWLQPFMDGLHHVQSVHCTM
Download sequence
Identical sequences PTSG_00005T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]