SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00098T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00098T0
Domain Number 1 Region: 1053-1338
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-68
Family Protein kinases, catalytic subunit 0.0000394
Further Details:      
 
Domain Number 2 Region: 92-326
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-24
Family Kelch motif 0.0087
Further Details:      
 
Domain Number 3 Region: 436-759
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.83e-23
Family Galactose oxidase, central domain 0.02
Further Details:      
 
Domain Number 4 Region: 954-993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  PTSG_00098T0
Domain Number - Region: 860-903
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0549
Family Galactose oxidase, central domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_00098T0
Sequence length 1377
Comment | PTSG_00098 | Salpingoeca rosetta CTR1 (1378 aa)
Sequence
MLVPLPSRANPVYAADDEVELSPPMQFMGGVSAHASASAPLAGGGFDRHRSKREVVPSST
VSTPLTTTPNATAGGGDDGEGAGLLTWHRSSWVFVQSPGSRLSHTMVGLSPRKVNGTLDS
AANGRALLFGGETARSPVNVVLNNEPFVPSNDLWLFNVHTASWHMLAPTGPRPPPRTAHV
ADLVVLNGLDHMFVFGGIIYERGNINYRFLSDLWLYNVSENAWDKLQLADGSPRPHPRSG
MDGAMCGPTTLYIYGGTSTRGCTVDMEECPTDGADALIVKEDLWKLEFDAPGPLQWELIS
TPASPGLRSSHSMICMRDTLYLHGGVAAPIHFANRSASSSLAVVDDGFIWTLNTTQQPLN
WIQSPVAYSFVVDDTFSKEQFVSSFAAVTVPFSENTFGVVGGQHLATTWRPFILVFDIDK
SEWTIFPPTLTQLQSSFRVFCAATNVAGTVLFHGGHNILTVLSDLHHVIPENRLVYPVPQ
QEFPVERAYAAVTFARDQNLLIIQGGFNGQVPLTDLWTLDLTTKTWEHTFDRNPLGARFG
HFVHAHGKHVFFGLGASLVGLYKDMFVFDLETKQWSDVTLNNPEHYLKEDLPRVSPMYAS
YSPTGGNTAPTTHMLFFGGLRLVGIDEGFLRQVHFMGDTWILDTSDVTAPTWSRVDVEPG
QAQPIARNLGAMTPFQLPSGRLGIFLYGGFATPGIEAGTPIKVRDVLDVTEIMSDAWVFW
ADTNTWQELNARLPGARAAHSVTFISSHIFLYGGTSQKPHSGDILGVSTVISTEDTWVLR
MDTLDDPNASIFQLDGADSDSGAGAGEQSRRRESHPSSPSSSSPSSSSSSSSSSSYVRQR
RQQQRPLPESVGAAQSLDNWLLMPASLSIPRAHHFIFGVNNSLLAWGGRDSQGFHDTNVY
DLRLACLPGFASATGDFADCQPCAVGRFQSLIGQTRCFGCPPDVTTASEGANNPVMCSVC
RRGYCRHGSCHVSDRLLPVCDCSTGWSGDRCEFNLAASISLSVLSSLLGLVGFAYLIHRY
RKRAGKFKTYAQLQEKLLGETKEELEELERAWEIFPDELQFIKRIDTASPGAFGQVWLAK
FSDVMVAVKRLKHELEELDEEAHAEFISEIKFMRGLRHKNIVYFYGAGFMNNQPFLVAEH
MARGALDTNLADSSIDLSWRRRLGFLLDTASGMNFLHSLNPPRIHRDLKSPNLLVNESWV
VKVTDFGTGRLVEHLQADAAQSLELTDSMQPTMTSNVGTLLWCAPEVHAGKLYSLSADVY
SFAIVMWECATRELPFNEIESPWDIREAVDGGHRPPLVDDAPAGFNDLMQRCWHQDPAER
PTFATALVLLTAIYEAIRDDGSTGVAAAAPRSSSSSSSSVGRKPTSSGSEGVSSTHM
Download sequence
Identical sequences F2TVI5
PTSG_00098T0 XP_004998653.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]