SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00112T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00112T0
Domain Number 1 Region: 634-743
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-27
Family MBT repeat 0.00057
Further Details:      
 
Domain Number 2 Region: 2355-2423
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000899
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 1649-1724
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000115
Family APC10-like 0.015
Further Details:      
 
Weak hits

Sequence:  PTSG_00112T0
Domain Number - Region: 73-126
Classification Level Classification E-value
Superfamily E set domains 0.0002
Family Filamin repeat (rod domain) 0.02
Further Details:      
 
Domain Number - Region: 1956-2025,2089-2155
Classification Level Classification E-value
Superfamily ARM repeat 0.00768
Family Armadillo repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_00112T0
Sequence length 2612
Comment | PTSG_00112 | Salpingoeca rosetta MYCBP2 protein (2613 aa)
Sequence
MVRFIAKRRRDKATSSSEPASKGKANGNDATAGSSANADADKSSARSRDVLAGLEPRKTA
HGIEYQSLFARGGVRYSPEEARLRYLQKAVEQVSTDAVEDGVYAISWKPTEPGVYDVDVV
VDGQSILAEKRAYVVEEDDHFNSSDKASTASDEEEEAARAAVDKELEELDAECENDVVMT
PGSSKFKAIKDVVVRAAPSQESIGVGKLSPGDIIDTSDLQTNAEGMWVKLAGECIFSCVE
ESMRHLDAWVPHHISELFGGAQVLEDLAEDADVDSKGSKQSSAESPAGMSAPRGGFQLGP
GPFGSFGSGPSGSGSLGAPAGMSPFGSAFGSGPAGGFGVGPVLSARPPAPGPRPPGAIEG
LTYQKNEVPTFGQPVRAFGAPAPAFGAPAPAFGAPAFGAPAFGAPAPAFGAPAPAFGAPG
PFGAKPFDFGGTKKDSPSSADQAGSALAKTVKKKGKKKPAGKKAFDMFHGEDVVDLVTQE
SSSAPGEAKPFSFGEAAKLKTGSDSSSSSSGAKPEAAASKPKADEPPLFLERTCRQASYT
FPVARLVRTIYAVFLWHANFMPDAVLLATHLKFQPDMLRPRTEEKQRQETQRLRKAFSHP
PPPVESIEHGATVYFTNSDSSMPIKAKVKKVQVQHIIINDLKVEVGMRLEAKDRLNPNMI
APANVIAVLPDNRIRINFDGWSARYDYEASLDDADLHPIGYAQSINHKLERPNGYGERFV
WPEYLRDIKARPVPFELLSHRSNQKLIELDKKAREMGNGAIAHPIHEHLLRHHLPNHGWV
CDGRHQQHDFCGCDGGGGLFGGVAYGGTPRFRCMDGCDYDLCLGCVATSRLLYDRKKYPR
REDAGGGGLFGGRDGLFADDDDDDDEPSTSEEEEEEDLFGDGSEGDAADRPTRQDVKVLL
EVEASGKEVEVPLSNIRFVDDVEQEAEESPAALAASQVPLVPRLLASSWDQKEDRALFVL
SSIMRQFSKASGLTIESAFYGEPAANIGKDVTTTVQYFVSEGTLQLPWKYDVLFGPTRLP
QPKLRIVYKVRGVDGEELINETDKDVPVRLDAEQIARARGVDWDKVMRKLTAPDDDEDDK
KKKKNKGKQKDKKEENAGPVPVPFGGFGGFGGGFGAPQQDQVCELCKETHPSPITYHMRK
QHPGCGKNASGMGYNSGGSYDSGWVGNCGDGGIGGNTWYLLCRECREKYMHEEKSDDEEE
EEGVDALLATALATALPSIDDEGEAEADPDATTAVGLLKRVGLKAEFLLNLEPFEHEARF
TSASAADDVDSDATLDPTAGSLYMELKQELLDLQPPEPDADVLGRSISAAPTRARPTLRK
QQTLGGEALRKLSGDITAALSPLRRNVTDDPTALSSTAAGSLSPQRGKHTRRGVSSTSGA
DDAAGTGAGAGAGAPRPRRPGQLSRALSLPYPDDEQEAQHTTVPNSPTSARGQAPRGFTA
PHEALLGRPSKQLRKFAKSDGQAELTKNVLDFVSSSASTERVARLLKAEAEHVYQRLQGL
RLFIVLLKSVMTPGAVQDLLWYFVSTLAKGRKPEVDSEGVDVPLPLGKHPLGDIDTTNTL
VGFVRHTYHHLLSVVLDFMRALPASSPVQQIALRCWALPFQEADLPFLHRSQIFSVVSGH
VSLGPRAREAEGEQEVVEWLERAPVKAEVSVASKEALKDSLSDSDTQTFWESDESPEGGQ
RWIQLEIAPGERAEQVAVFIDNGRDSNHRVSKVRVETGPSAEKLVGFGSSISVSSKFVGW
LTLPCAHSSKGGGGSSSGGGGGDKKAGGGGSVGDDDGMSACASDAAAPAGGDGDGDGIAV
AMPPAPRVVRIHLSGASKLRVRQVRAYGPAIQDASVPNSRVQYMRHRAGEALRLFRELTM
QIFMSGKTAASKKKKAQGEAGAEGLGVGAQQQQQQQQQAQPGEAAGEGDNTEMKEQVVGI
LFQEGQELNALQAEVCRHFFNEVKRKTTALTESGACLQETDEVYMHELLTLIRSLTASEA
GLRAISKESDMLNHLLVLLNIGTTRVQQQAVATLHKLLEYLPYDRTVKMVDTLPIAKVGY
GPLSVLLLTVAKCLTLQVRGRGKDKFSTTVTFAQVVDKDAAKSALPSKWLVGHVEEEVVP
SVLMLVSDLVSKLPSYQHKSKAVLTQLVSTLTEVEGKEGSSRQEVITDPQVWLSLAALCV
IDGATALDMTKAASSEARESQLFCDNHDDGETHATHACAECEMNLCTECERVLHLPRRKR
DHTRTRIGEASAQLQVELNEGCGRARLPQLLAIADRKSLKAVLEFKMASGTVACRFCEQP
LGDDGGMAQLVATGIKNVCSDPDCIELAKNSCTKTLTCGHACCGIRGEEKCLPCLRGCKP
EVEAGDGEEGGQVARAPLTQDNEDQCMICFTGALQEEPCIQTPCGHVFHFNCVKRLLEVR
WNGPRITFGFCKCPICSSSWIHKDIPALQHLLQPLNDLYDEVRRKALMRLNYDGKDEEAP
TEEEPRAEYAMRKYAYFPCHKCGKAYFGGAAACEAGRGSADFDPTELVCPLCVGGAATQI
CRKHGTEFLEYKCRYCCSVAVFFCFGTTHFCNACHDQYQRCQSTPKELLPQCPAGPCLTQ
LEGDECPLHVKHPPTGEEFALGCGLCRNAQTF
Download sequence
Identical sequences PTSG_00112T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]