SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00113T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00113T0
Domain Number 1 Region: 411-423,456-561,685-695
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.22e-21
Family Regulator of chromosome condensation RCC1 0.013
Further Details:      
 
Domain Number 2 Region: 1273-1385
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000124
Family APC10-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_00113T0
Sequence length 1882
Comment | PTSG_00113 | Salpingoeca rosetta predicted protein (1883 aa)
Sequence
MLSTAKVHVRLDGAADWSVDDGPSRELTFPSGVTPLEVVTGQSFAVARSDSGDLFVTSTI
PKLFGVDMVRVVVSTETGCVTCVCFLLLLLLLSLLLLRLRQGVWNNLPKPAGFSCVGLRG
SHAVDGCLLLGDDTIFIFGEFEGTDEAIEQRRQRHAKATASSTFLRSFFKAPSSVADACL
ASGMAVLALKDGTVNVITYKNPDGDKPKQQDKRKGKKDKSKEEKGKDIKLSQAVLTTLEE
LPVGRLFSRSARRKAKTCHACSAEFSKDDHVFTSIDRELAKFYCEKCVTKNKLSELSVTC
KTLRVPLGGSGVEPRRVCVNEKRLVVLTSEGRVFDSHPGVNDDTCSVTQARAKEEQEKLK
EAGALPCDHDFSHPAGSVAHICPACNQCTNSGKACYRAAKKDREKGAPCGCGDGDPGCLK
CGMCKTCAKEGKREDGADSEQKSLTAVLDPPHAPRVLPEGFELSRVQQEEEFADVCAGEE
HVVALTVDGKVFVSGSNEDGQLGLPDMVCTVPFTHVPLPSEARACGIAAGARHTAVVLED
GRLVTFGRSDEGQLGAGRAVTDDDRKAAVEAAVDAAAKEKADAQEEEKNKEEGEGEDDEM
KKPAADEAKKGEDSKEKDKKEAEQGDEKKAEGAEQKEGDQEEDKKKKDDKEEEEDKDKAA
AAAAAAVAEDKAVAERASKAAKAATNAPRIVELPMAASTVSAAGSATIVFMGEDVFDKSV
LAKSSMACTGQYLLALTPQGGAADAATDGTVCLATFNLTSGLLVEKNTASGIGRGSCLCF
SAQHDTLALYDNTAAAVSFHRTLLTDVERKPHERQRSYSDLAVDPRAFLLSPSNVVGPES
AATAPRALASTFLSVLAAMNHEPVGRPKAASDKVVPSSPSTGIGLEDVTHVSRYSSQGGG
WGYGGSSPDAIGFKVNQPIAICGFGLYGQDSMSFNATMKLFVDGKAEEPLATKTTTYSSN
CPGRNYAAILFDEPVTVEPHQLYIAWALIQSPHSSICGSSGQSVVEEDGVQFNFVSTHHG
SNGTDVSSGQVPAILFCTLDKLQGSTDLFASTEQSFKLSPRFYRQADVGGLEGLLNTLSS
TWQHLLKAKAVPAAGKSTKSNTHFHVGVFARCLHLIEQCVRSNFELDWLGNVTTRPKPDV
STTLFEEVLRLRHFARECLSTAPKNAATRKALELITSTFKQLFKLFYPTTRLQRDLFLEV
LMHGKTDVSDPQAEAQPLLLALLSVFSQPGFNFPKLFLAKSTLVSETAKTMQVVEVEGED
AYEALTVSTNSVRANALKTSEPEVWESNGPSGTHWIQVQMQPNVYISELTLVAASRDSYR
PSRVDVKVGTEDDLSSMCSINCDAERKGDNITMLSDCDEYYPVVRLCISADGINTRIRQL
VVVGEQRTLQPGLADAEVMTPYSEYVMAQCGMFAGKSDDDDVSSDLFREVVHRLIAMVRG
TAANGSHSIEELVAALLTSTTTQLSLKSAMATQHPQPQGAAPAAAASQESQSKLASGFVV
TVLQEALMVLNSGQVDVSTSPLFTKILPSLLAHASFLEHASTAEVLEVVGLIQELLGRIA
AMQPASSGSKADSGHNKADNTDESAASSPRLVVVETAHPYEQAVRQQRAISFDKDTSCLG
IEFDPRSSFSQVEDKLVIWVRRSDSEDFVEFMSFTGNTDFPSQSLILPGHAAIFELQTAT
DYQDLERENNESCFGFKATVVGYKFSECSRDLLHILERELTLVGGMCAASLLKKKAITRL
SRAELEEDDEDEGKGKKHKHKAKLTSDEKKERKELAAALDAMASSLFSKGLRLPDQHKLL
EFFKEPSVKALMHFHPREEGNFDQMFLRNFVDATPNTPGGRLAEWLQGPCAVNPRSCTLE
YMQPGKEVTTIKQGDTCKFKRE
Download sequence
Identical sequences PTSG_00113T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]