SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00196T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00196T0
Domain Number 1 Region: 4-214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000414
Family Motor proteins 0.0051
Further Details:      
 
Weak hits

Sequence:  PTSG_00196T0
Domain Number - Region: 1051-1120
Classification Level Classification E-value
Superfamily Tropomyosin 0.00399
Family Tropomyosin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_00196T0
Sequence length 1233
Comment | PTSG_00196 | Salpingoeca rosetta predicted protein (1234 aa)
Sequence
MSRSSKIQVVCRLDTLEDSDDQVAAVPVEDDTLRINDDSYQLTRVFGGEASNRIVANYVN
KKPIECFMDGFNASTIAFGASANDTIFGSSTSPGCVYYAIEQIHTRMRAAGGADMWQLAI
GCFCIVQGRVVDMLSPEYSRGAHRTTCGSPDQTTLVMPTEEVEAADIVNTALDRHQDLAA
MYGDDTCHLVLRFALYDTTLKRGAYLTFVHAAGLATFLRDGRCSDAHASSDARTIVSLLE
QVGQAKHAGAASTTSSDVASSPAAKFVATLLNTSFIGLVACVGARESQATATTSAVSLVA
PLAVAKCTCTRVPSADFEEFAGTERVLPTFARSPRQQQQQQQHEYRSHHARQAGRGRHSP
SYVPHSSALHGTDTAPGFTGRRPGGDALPSRIDAPSDDSPSSDSASPSPPPKGSSHHHHH
HHRHRHRHHRHGYEDEHEDEYEDSPQQQQQQQQQHEGYRRYPDPRPYETPPAARVPASRT
SGSTGDHGARRDPHDADLSRLFDLTEDEQVAAPDAGHKRSVRFKEEGAAETTKGEMHTPP
RTTTAAGGGGKTERGRDARDGAGWRSTPWETPETRDVHRATQELLAQEHRHLPSRASKTT
AATKSAAAAGGARGGNARYATRARAHDEESVHPQTLRAPPAPAAATAGTTTYYSRTHVQP
SGATTTTTSAAAPATTSVTTTSIGAQRPMLSAVHQAEAARKRAAELLRRYSRSPPSTTVT
TTTTAAAPVADEERHVRDIRGLRRRAEVREATDAYTRGNFEIDEELQEIALCGSIRDKRR
ELESVDGAERHMSGKGVGTGGSTTTTVHFAPSSLRRQQTQESGRAKETRTTTTTYYGGGL
ASSQRRVETVTTTEEEPNIDHVRVRILEEENADLKQQLATLRDEKRAAEEECLQMCAERD
DAKRERTTYEAHFDAMQSDCNAQKDLVAQLSRELEEAKEELAAKTRALKEQKERHVDVAD
QLEKAGMLSEEFQAELQRCREENQKLRKDNVALAQREEATTAAHAQLESELEDVSARLAA
AQEEVQAKKETIRELRGANISLEQQTERQTRKIESLRNELELAAVSHDTLRQQVKDERGA
VKKLRGEAHGTAQQLGQVQDELDKVRVERDSLRASLTDADENGQRLQAQVEAFRAKLEAM
VKRVEGYKKQRALFLKEQQQLLKILAAVHSLVDAAGAHASKCQARGFFALKSRKLHEDLQ
RVMDSLMDHIIESSSKLSSRKDILQQLKEMQLF
Download sequence
Identical sequences F2TVS7
PTSG_00196T0 XP_004998745.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]