SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00266T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00266T0
Domain Number 1 Region: 58-366
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.15e-41
Family beta-glycanases 0.048
Further Details:      
 
Domain Number 2 Region: 712-802
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000808
Family Ricin B-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_00266T0
Sequence length 855
Comment | PTSG_00266 | Salpingoeca rosetta galactocerebrosidase (856 aa)
Sequence
MAVALFGFGPVAAAQTLVLALVLATLTVGTHPTSAEGSGSTLIVDKAHVGEPLDAIGGLS
GGGATSRLLIDYKEPQRSQILDYLFKPNFGASLHLLKVEIGGDSQSTDGTEPSHMHSKDD
LDYKRGYEWWLMTEAKKRNPNIKLYGLAWAYPGWVGNGTSSPFSYPNLTADYISKWLQGA
KSVYGLDVDYIGIWNERSSDATYVKTLRRTLDDAGFKHTQIVAKDGGADICNTLAKDKSY
ADAVSVIGLHYPSDFSDYSQCYALNKPLWASEESSSYDDLNGAACWARVITSHWALSRMT
GKHLAPAPPLLLLSSIMWNLVGAYYHGTNWYASSMMTAVQPWSGHYWVSPVVWATAHVTQ
FTRPGWLYLNDSYGSGSLPNGGYYATLVDPNSSDFTITVVKIDHDHAPCTRPALPPFDVH
AETVTFKLAPSMGGSSVPALAVWYSNFQNETQGIFKRLSDVHVGTDGTFSVHVPVGAMYT
ISTIRDGPQKGSHGPPPPSAPSFPLPYADAFDEVAESQEGKYLADQIGAFEVHADAQGNK
VLRQMVPELPIGWSDHGSNGPVTVIGMREWQDVFVQVKVRLSSNITAHDPAACVAARVDQ
MWDRGIVFCVYASGNYTLSIGGPKQSNGQPADVVSQGQLPTPIHRDHWHTISITCVNSSA
SGMFDSGFAFRDVAVPALDTGFAAIGTNGWFAVEYDALSISEAGHWVPPAPKCANPKRGD
KLGARPCATNGFNTTDQLFTLRADWTLVHDPTGLCAQAAGTGGGAAVALAACDPSNPMQQ
FKNDYTRVRNTEMPVFLDGQNPVSAALTGTLAGGVSVGGNGDWATWSYFPNTHQLRNQYT
AKTNLGFPMCLTVMC
Download sequence
Identical sequences PTSG_00266T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]