SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00284T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00284T0
Domain Number 1 Region: 406-503
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.51e-25
Family alpha-Amylases, C-terminal beta-sheet domain 0.003
Further Details:      
 
Domain Number 2 Region: 206-403
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.26e-20
Family Amylase, catalytic domain 0.0066
Further Details:      
 
Domain Number 3 Region: 77-171
Classification Level Classification E-value
Superfamily E set domains 5.95e-16
Family E-set domains of sugar-utilizing enzymes 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_00284T0
Sequence length 504
Comment | PTSG_00284 | Salpingoeca rosetta starch branching enzyme II (505 aa)
Sequence
MSEAKEAKDAVKKASLEQQSTKDQLGKAQPPDLAKLFELDPSLQPFEAAITHRYGRFAEL
KAKIDEHEGGLAKFSLGYETFGFNPCEEGIVYREWAPAATAVSLTGDFCDWDRDMFKCTK
NEFGVWSVVIPNKPDGSPGIEEGSFVKTCITTKDGDRVERIPAWITRAVQPKGQIHYEGV
YEPKTPYAWKHNRPDRPESLRIYEVASYDDYFGSDVDEEAVAYLMLANQLIHDVLPSAIT
VAEDVSGYPAICRPVAEGGIGFDYKLAMAVPDMWIKLLKEQADEEWGMGHIVHSLENRRY
KEKSIAYAESHDQMYTHMSVLSEQSAIVDRGVALHKMIRVGPQLRNEFGHPEWLDFPREG
NNESYHHARRQWHLVDDDLLKYKFLFAWDREMNQLEQRFGWLHAEPAFVSCKHEDDKIIV
FERAGLVFAFNFHSSKSFPDYRIGVEQPGKYKAVSSTDAEAFGGHNRVDLSADHFSDPEP
WHGRNHSMLVYLPCRTATVFARVD
Download sequence
Identical sequences PTSG_00284T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]