SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00429T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00429T0
Domain Number 1 Region: 203-529
Classification Level Classification E-value
Superfamily Subtilisin-like 1.96e-82
Family Subtilases 0.00000000839
Further Details:      
 
Domain Number 2 Region: 524-662
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-26
Family Proprotein convertase P-domain 0.00051
Further Details:      
 
Domain Number 3 Region: 1309-1473
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.11e-25
Family Growth factor receptor domain 0.00016
Further Details:      
 
Domain Number 4 Region: 737-855
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.8e-21
Family Growth factor receptor domain 0.00038
Further Details:      
 
Domain Number 5 Region: 965-1134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-20
Family Growth factor receptor domain 0.00029
Further Details:      
 
Domain Number 6 Region: 57-137
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 4.25e-16
Family Prohormone convertase 1 pro-domain 0.0021
Further Details:      
 
Domain Number 7 Region: 1174-1202,1236-1350
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000166
Family Growth factor receptor domain 0.001
Further Details:      
 
Domain Number 8 Region: 670-748
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000179
Family Growth factor receptor domain 0.00068
Further Details:      
 
Domain Number 9 Region: 873-988
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_00429T0
Sequence length 1671
Comment | PTSG_00429 | Salpingoeca rosetta protease PC6 isoform A (1672 aa)
Sequence
MAGMAAQGVKLVLLVGLVAAVVMVCALERRHGDAQDNANGGVVTAERLKKVGEPGAFHNL
WAVHVDGDRDAADQVARAHGFRNRGPIGGLDNFYHFELSCDPEQEAAGECVQPHRHAAPH
THRLLNESRVIWAEQQRLLHRPRHYAVDLDTLRAGNAGNAGTAPDEDMSALASMDAAAPG
GGGPESQGGLGRVRRDFDADAYAKTINDPSFSVQWHLYQSHSDNHHNVLPVWNEGITGKG
VVVTIVDDGIEYTHPDLKANYDPKASTDINGNDDDPFPDERYPINKHGTRCSGEVAAARD
NRKCGVGIAYEANIGGIRMLDGPVTDSVEAHSLSLNPQHIDVYSNSWGPNDDGRTMEGPA
LLARKAFGDGIAKGRGGLGSIYLFASGNGGSADDCNCDGYTNSPYTLSIGAIDEHNNVPY
YTEKCASTLAVTYSSGSGTRSITTVDLHNGCTHAHTGTSAAAPLAAGLVALVLQANPKLT
WRDVQHVIVRGTRTPGNSWDTNSAGFKMSYAFGFGVLDAKKLVDVARTWENRPKQLQHKN
TIKPNSAIPATQSMSDALTVAFDVRRQDTTIAELEHVQVMVNINSPRRGDIVLDIEAPSG
TKSKLLTRRASDYSNSGIHWTFMSVRHWGESPLGKWKLYARSFGTGSAKLVDATLILYGT
TATGDHSGGTTTCPKGTYRDSSGQCLNCDAECDSKGCTGAGPTACVSCQHYEHAGTCVAD
CGDIGMLGVDDSKECVKCHPQCKGCFGRTEYECVACVGATLREGGQVKCVDTCPKHHYLD
DDNQCQACDAECNTCAGPGPNNCMACTHVQLFDGTCVDACPEETYESSDGVCMACNGQCR
DTCTGAGPTKCSACKGLRLQLQEDDDSSVVTKCVEACPPSRVPNEHQVCVCANHTYPDHQ
SLACLPCHAECLSGCDGPDVTDCIGPCAHAQHSTECVDECPADYFASTDTAAFHALYPHA
TIRSSNVCLPCNDQCASGCTGPSAHDCTSDSSGNRCLAFEDEDGACVPACNKGTYEDVAS
SKCRTCHAECDGCIGAGPGACLRCKHVSHDGTCLASCPVHMYATERSVCEECHPECADVC
FGPSDRQCFEAAADVSATEPSCKSVHLGQQCLSECPVSHYEDIDFACQACDGECGEEGCH
AAGAASCNSCKHVTASDGTCARQCQADEYVDDAQMCRPCDASCKHGCSGPAAGDCLDSGD
CTTQHQSCPSDSYFDTAVCECVKDACSSGITYNGNCVPSCPSGTYASEDGTTCHACADNC
DACTGPTQQECTACVHAGVVDTDGTLTCFDDSSCRDPARQYLDSTDNLCKPCHAECNGCF
APTNRDCKACVHVQSQGTCLAECPRGFYAPHAGDGGDEGSSAGTVVVCQPCHGECASGCS
GPGASNCTACRHVQLDGQCISTCPVGTYHNTATDTCEACDGECLAGCTGPTAADCAGGKC
VNFIHKGTCVSACPVGFFANEQAMCEACHPSCPGRCVNATPSGCVLDTSTTPSTPVEPSP
SPPPPSSSTTSTVTAGASTHAQSHTTARAHQPPATADTTTTPADRTSSSGAQYLGRVPTS
TVEIAVAAVLLAVIAIVVLFVVVRLKGRANRARVSYQRVKLTELLSDDDSDDDLVLHGDH
LAPFDVVAPSVSSSSSSQSPPTNGAGRGHARDVVAEGTSVQLLADFPQSDI
Download sequence
Identical sequences PTSG_00429T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]