SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00432T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00432T0
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-19
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0002
Further Details:      
 
Weak hits

Sequence:  PTSG_00432T0
Domain Number - Region: 264-350
Classification Level Classification E-value
Superfamily Tropomyosin 0.0301
Family Tropomyosin 0.007
Further Details:      
 
Domain Number - Region: 167-207
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0562
Family N-terminal coiled coil domain from apc 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_00432T0
Sequence length 379
Comment | PTSG_00432 | Salpingoeca rosetta Homer3 protein (380 aa)
Sequence
MFKTQAHVFQIDPQTKKSWLPLSKTAIPVSIVKQEDGTHRIRAAPADGDEVMSSTLSQGM
LFTKTAPKFGQWTDTKAGTLYGLGFGAETDTLNFADAFSEALAKLDDSSTSTTPASSVDM
PPKVAPKPATAAKPRQEPAKEKESAKPNKPSSASTGDAIGSPVDSQEVATLRYENERLRA
ALATSSANAKKWEEELQNLRNTNTRLKTALQESGKNVLQWKKQLAAWKDETTRLKKLLKE
KEESSSTPDASSTASQPDQEVVTKLEEEVAAAKAELAEVRQQLEASQNAEKSAVDQQQEA
EATVVQLKEQIKTLTAAAEYQSKYERLAEDMDAWKTSYANKLADLDDLHVALGALLQRSA
NHTAGVTKCTDWEAAHSVS
Download sequence
Identical sequences PTSG_00432T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]