SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00501T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00501T0
Domain Number 1 Region: 1246-1518
Classification Level Classification E-value
Superfamily Kelch motif 1.03e-45
Family Kelch motif 0.0096
Further Details:      
 
Domain Number 2 Region: 58-362
Classification Level Classification E-value
Superfamily Kelch motif 4.84e-39
Family Kelch motif 0.014
Further Details:      
 
Domain Number 3 Region: 1060-1155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-18
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 852-883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000344
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 930-982
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 6 Region: 1880-1937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  PTSG_00501T0
Domain Number - Region: 1152-1218
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000133
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 980-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 1971-2017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 2021-2069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Laminin-type module 0.037
Further Details:      
 
Domain Number - Region: 1541-1579
Classification Level Classification E-value
Superfamily Kelch motif 0.0128
Family Kelch motif 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_00501T0
Sequence length 2444
Comment | PTSG_00501 | Salpingoeca rosetta laminin B1 (2445 aa)
Sequence
MAACDTTQHAASCGHCTCNPWEVDCPLAPWARVAADPVPVVSEHGVAAHAAVYHAQLDVL
ATFGGLTVNGPSSQTRMYNFTAQGWTTLAPAAASPAPAARYSHAFWLDGDALHIHGGVNA
SERTAAAYGIAHHPAHYTDDHWRLDLQSGVWRRVDARGVPPPAVAGHTATLVGDTVYVVG
GRTADTLFSAYVHAFNVTDEAWSRIVPLAAHLGKVSDHAAVYHPQSHAIIVSGGYIPGNL
RFPGRTSQVLLFSLTEPSWRVLVAHDDSRPTLAFHSAVLWGRFMVLFGGFRHSHYEDEEC
HSNDLLVFDVDCATWHPHTPALNSPFSGRFAHAAAVRNGHMLLHSGFSGIFHTDLLITDA
STLTGRMGFSRFERASMPARDSDVIADVFNPSVGVAASVVSVVDEANRVSVPRHTLFLAT
IVASVTGVHGFGVKSNDPDGFFGVWAAPEVAWQNATTPPQGSRLLFVQHTSQTRGMVVYT
SVNMTAGQPYYLAFSTGARGGIRYEAKLEWKQPADAAFRILTADDGVHQFQTRACARHAD
CSSCLYDAACFWCDGQCRSSNDTATSTANTTTTTTTTTTSSGSSMACASAPVLSAGLCTD
CSTALTCHECVDDAVPGCAWWRDTCVPVAAVSDNSSTTDAAACPAPCSRREDCSACIGAD
AGATCVYCESTASCIDRATSTAVNAFGQCLSFAYSSDESSQPCANCSVHATCDTCLNKLG
CGWCAHPDDGDVGACVSGDFDGPAEQQCPLVSLLANTTTSCHNATTAANSTITTQEPTTT
GGNSAATANTTTTAAPLSTSSTPLPLNATDPSSNTTTTNTTMDAVACSANNTYVLEPARG
EFYYPHCPDVDECALQIDDCGPNAVCRNTNASYVCECEPGYASASVLFPGRSSAPCMPQC
TNACVHGTCTAPDQCTCDVGWAGATCDVDCGCNFNAECTNATTFGVCPVCLHNTTGPQCG
TCAPGFYGNATDPGVGCRACECNGNGDAAKGTCDPSTGVCYCTNYAAGDSCEQCQPGFYR
RNGRCYAGCRYDDRAYNAVGWTSRVALVEPAAGFGTHTDVRSTHTSDTSCMWLIRAPANH
SIRVTFEFVSVECAYDYVHVFDGAAPHSSKVLAMLNGELPTTTVYSYTGEVLVVLFSDIS
YELRGLEATYAIEECPALCSGHGSCDGTGRCRCDPGWSGDACAAENCPRNCSEHMGQGTC
NAARTACVCTPGYTGRDCSAQEQPGVWRPLLVGSAGDAGDAGGAGAAAPVGRSGHTAVLN
AAGTQLWVFGGLRGNEYLGDTWVLDLDTRVWSEFEMAPSSLTPAGRHLHVSAWFDDRLFV
MGGATGPATYTNDVWRLSLDKQAWTHVSTSGDAPPATAGHCAARVDNTLYVFGGLSQDVG
LAATLYALDLGSSVWTRVSTFGSRPDGHFAATLVHDAARNQLILFGGRRYVSPGTLRDPV
RNAVMRMFDLSTNAWRVASTAPIFCESASCIARSQHAAAVVGDYLVVHGGNPFLHRTQNM
CHSDETLIFNIPCGKWIADTTAAAEAAATSGSDGDMTASLVPLLRKAHQAVALPSGEVLI
FGGVSTSALNDVYVYRPRAEYCAFHLSVRNCDDDPSCVWNATASACVVASGAGLRNCTSP
FTDAAAAQCTDRSRSRGLFSQDECRACVSHDACEYCPSTTSCAATSDAAACPQSSPVVFD
SSSDACGDCSHLMTCRSCLSDPACTVGQGVCAERAAPATTPVDVDAVCLPSCTVHTTCGD
CATQSGCVWCEGTQSCVSSATVTTEFAFGQCFRYAGEASTCPILDCQDASECDDCLAMAR
CGWCADPGLNGTGQCLQGTLAGPGIYAFNTSSTCSGALRSVVGEAALALPAAFRNNDDDD
DSDGTAILARVPEDTLNHTTWNSIDCPDVDECALGTALCSDIAVCINEDPRLVPGSRGYR
CLCPANYTLLDDGVTCAAVCSTYGCVNGFCSRPDVCDCYQGWYGRNCTSNCGCNGHCTCS
DTSARSACLDNTEGPDCERCQDGFHGAAEGNGTCLSCLQVCNGHSVHCRPNAVPLPGQEN
EPVCRNCSYPSRGSYCEQCMQGHFLDPAILKSARDAGLAPLDYIEQNASTVNSSCVPCQC
NGHSSVCNSITGEECQCKDNTLSSANNCDEDEYGSCYHAQCDTCMDSQSYSGVVLQLSGD
PRDGRPCFVVPSADVAVQQQLGPGDLITFEITPKFTNVNMRLFAEVDRALPSRVRMYVLR
DANVTVDERTHQLEFGQAPVFAEDVERRTLFVAKYKAYRFAEDRFFVALHNTGANATSVL
FYFTQPVVSIDLVVFFTVFFSAFFLFAGVVIGASKIHVVLSERATTIQEQTQMQTLARRP
MGKLLLAWGPPVISGDAAVNVANAISTGELQPTPIASQPTRGNQSSLVTMLVELPSGTAH
RNLSLATANVRVPREGGVRNRRWRRRRGDDDDSNNSSSISTSRL
Download sequence
Identical sequences PTSG_00501T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]