SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00514T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00514T0
Domain Number 1 Region: 25-346
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.84e-79
Family NagZ-like 0.00016
Further Details:      
 
Domain Number 2 Region: 348-411,512-668
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 2.62e-47
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0041
Further Details:      
 
Weak hits

Sequence:  PTSG_00514T0
Domain Number - Region: 436-477
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00049
Family Hairpin loop containing domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_00514T0
Sequence length 775
Comment | PTSG_00514 | Salpingoeca rosetta predicted protein (776 aa)
Sequence
MQRATNVSVVLLVAAAMVAVAAAGTPWMDLSATPESRAKALLKEMTLDEKITMLHGSTGP
YVGNVPANTRLGIPALNLNDGPQGFRDNAHPGTTTCWPSGLTVAATWDLNAMKDWGTAMG
KEFYDKGANIQLGPGLCVARVPVNGRNFEYLSGEDPFLGYTLVQPVIQGIQSQGVLANAK
HYVQNNQETNRSGVSENVDERTQFEIYYPPFQGALDADVGSFMCSYNKINNVYSCENNQT
LNVDLKDRLGSGKRFFVMSDWGATHSTSINEGLDQEMPGGTYMSTKLKTAVQTGAVSQDT
LDNSVLNVLTPLFAVGVFDSNNTNSISNNVTSDAHNKLARQLSAKSHVLLKNDGNALPLN
KTIKNVGIFGAQGASSVTVHGGGSGSVVPPYVVTPMEGILAKMGLPPPPQPSKLPCDQVD
ILKNIDFFQPGNPSASANDVNECCSLCQQRSDCNIFTYVDADKTCWFKATAAGKTSSNGR
DSGVLRNPNPNQYVCENNQCVYFADGTNQTEVVDIASKVDVALVFVSTTSSEGSDRPNLS
LGNGQDELIDIVAARAAKTVVVATVPGAILTPWRNDVDAILVNFMPGQELGNAVADVLFG
DENPAARLPLTFPNIDNEVGFTERQYPGLDNAAQAYYDEKLLVGYRWYDARGVTPAFPFG
HGLSYTTFKYANLRSTGNAVSVDISNTGSRDGEEVVQLYLGFPSSAGEPPKQLKGFSRVL
VSQGGARTVTFNLTDRDFSIWDTSSHAWKKVKGIFNVYVGASSRDIRLSGTLTVA
Download sequence
Identical sequences PTSG_00514T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]