SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00577T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00577T0
Domain Number 1 Region: 11-149
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-20
Family APC10-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_00577T0
Sequence length 161
Comment | PTSG_00577 | Salpingoeca rosetta nuclear receptor 2C2-associated protein isoform 2 (162 aa)
Sequence
MAEETKQQQQRRLLDLAGEAKLRVSSVLNGDGKQFGKKFLLDDREDTCWNSDQGSPQFVE
LKLDAPAQVTQLAIMFQGGFAGKNCVLEGKVDGSNEYTELGRFYPDDVNHEQVFEGVNQE
NKKVHMLRLVFPESTDFFGRITIYTLKIYVAAEKKKEEEDQ
Download sequence
Identical sequences F2TWV7
XP_004999122.1.12839 PTSG_00577T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]