SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00597T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00597T0
Domain Number 1 Region: 172-413,452-513
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.16e-27
Family beta-N-acetylhexosaminidase catalytic domain 0.0032
Further Details:      
 
Domain Number 2 Region: 38-168
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 0.000000000000194
Family Hyaluronidase N-terminal domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_00597T0
Sequence length 565
Comment | PTSG_00597 | Salpingoeca rosetta predicted protein (566 aa)
Sequence
MTVLLRLAGLAVVVVVASLALLAPPCSAADSAETIINVWPQPVTQTCTGQSPRKLWQSFS
ITSTQDSLSPIIARYTRIIADIVTDKDAWAPKKSANSINGMVISVSQPAIPDREPSAESY
TIATNDNTIAVHTPSIAGAVYALETFTQILMEGQGAVPCDNLEVRDSPTLANRGLVVDVA
SRYLDLQTMHELIDSMAMLKLNTLGMHFSDYGAFRVATRYNELTDDLNGLYPGHVMSNLQ
EYASQRGVRLVPHMELPSHASGFQPAEDNVFFCTSDDVYTEKSVLNNDASTLSFLGDVIT
DVLTHFDTPYFFVGGADAAAAAGNCTVADVKRVFLSAVSSVTKPGTKAAVWDMAAAALTK
QLPKDTLVFATPGSKPVATAGSTIVSGYRNVNASMPSLPFAGEGASQDSYRDYTAMGPSV
TGAAATFFTNAMCEEQPCGSNSTITPPASFLAPRTQDRPARNATLSSLFPRVTYMAGAAW
NFRNITATDLRQRVYNFNAFMALRGAQVCPNSCECTLEHYCKDKYEHYDAEIKLFEAGFI
FGTVLATTAAASVIFLQIRRFTSAR
Download sequence
Identical sequences PTSG_00597T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]