SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00614T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00614T0
Domain Number 1 Region: 1260-1429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-18
Family Clostridium neurotoxins, the second last domain 0.072
Further Details:      
 
Domain Number 2 Region: 1067-1229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000337
Family Laminin G-like module 0.063
Further Details:      
 
Domain Number 3 Region: 1470-1644
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000119
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.095
Further Details:      
 
Domain Number 4 Region: 575-695
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 5 Region: 922-1041
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000612
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 828-888,920-930
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000141
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  PTSG_00614T0
Domain Number - Region: 469-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000171
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 418-468
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00132
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Domain Number - Region: 705-753
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00194
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number - Region: 1680-1740
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0706
Family Pan module (APPLE domain) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_00614T0
Sequence length 1742
Comment | PTSG_00614 | Salpingoeca rosetta chitin-binding protein (1743 aa)
Sequence
MRLAVASVVVAAAMLFAAAVTTVPVALAQSDPCSQTCTGDTYEETPCVDPVPSILLDYEA
GVTQPDITVVGDWNEFEQSGDNAFFGFFGDHFYLLNRVRNTGYGMFSFSVDREADYNISI
SYVYFSTSPGAFTDSQRYDVHTDGSRAGTFYIDQQQPPPDGNLTLLGQFHIEQSGYVFLN
ATVKDTSQTTVTASLDAVYITPADQAVADGSPPVCLPLRVCQDYEYETVAATATSNRQCA
LVRNCTVSVEYETVAPTATSNRDCATLRTCNATEYETVAPTPTSNRDCAIIEVCADDQYE
TQAPTPTSDRFCDDCDVCDDATQITDANCTSTTNTMCRNITEPYQYSPWSDWSQSCGTQE
RTRVETCADVKCLDQKPTRQTRSINGGCDDVCDDTMGQIECSCTPPSYLIDAYNCSSVYC
DIPTIANATASATGQLRLDEQALITCSSGYESVAYGTSFTITCTEMGLMNDTETCDDVDE
CAVNNGGCADMCTNLPGTFCCSQDGVYVYSEWSDWSTPLMETRDICCPVNANYTYGPFPD
WMPTCARQTRERPESCTASCGGVCTNRINTTQVLTNGGCEQICNATSGAIVCDCDPGYRL
TSDNATCEEFNPCDENNGGCSHTCVAMPLGQFECTCPSGFEAVDGFNCEDVDECAVNNGG
CFQNCNNTAGDYFCSCVDGFMVDPSNSSHCVRINCANPPPTLPASIPSVTARLNGTGPYQ
FGDELPYVCEDGFTVDGGAASATSFSLFCRASGMVDGQFADGAYDPSNQPVGISSRGCVP
IPTPDYGCKPSMINGPAVWMSMNAVRTTAAARTAVSTYVALLRARFAGGFNCTCPTGYRL
TDGFRCVEINECMEDSPCDHICTNTAGSFECACRTGFFLETSDNRTCTRVPCGPPPAEQL
NATASNSAPAVAVYEDVVVYNCYDGYTTNGDAGGSSFFFAVCQASGVLSPLVSIACLDVD
ECLSSPCDQLCDNTLGSFTCSCLPGYTNTSATTCEDIDECDDPSSCALDDNTMCVNTDGA
FTCECIAGYTRYNNTCQQQTHNLLDPLLSSGVVASPTAPQRFADDWVYFDGKGALEITQP
LFIGETFSLTAQVQIVPGTGGYIFAVTSATGSTRHFALYVYELTQRVGVYYRTDSDASTL
AVFQLDSPLDDGALHNIVLNVQAQSVSLQIDANTTTYTQNLGATISFCDPGPDCKIYIGQ
RASSAGGAYRLEGIIRHLRINALSTSDLVPIEDYPSPSAAGPSVIDLLDASNRNVVGSVS
ADADGALVFDGQSAVVIPRFHAVPLGATSTFTVTLTVNQDRNTNGYFVAKTDAIGGRFWS
LYSSATSNRVSFYYKTSGSTAQQSASFSVSLADGLYHRVMLAVNNATAQLYVDGSLAGTS
SLSGRVQDCSPPSSSCILQLGRRTDASSSDGLFFLSGAIASASVYSGVFMTADPTAVAPT
PALDQQLPISNASGLAYLDLLNDTVGFSVGAVRGTEGATFDGSSRLEVTEHSFSLGPTLS
VVGTLRADTGTAGYIFAKTSQDGNTRHLALYMSALSRLTLYYTSTASTSSRNLLFFPDVQ
LADGVVHSFLLQLVYTAQTDTTAVNLYVDGRMQTQQSFQGQLTDCGARSATCGLAVGQRL
DDNAAGGAFGMTGLIQLLQLFPHGQLSLADAPSVSLASPPYFSVLPAHYIPGQNQGGAYR
EGVSLEACARMCLDDALCLSFDAGTVGGSMEGSCFLSYVAAGDTGATALVESSLFAYYER
LS
Download sequence
Identical sequences PTSG_00614T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]