SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00638T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00638T0
Domain Number 1 Region: 260-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000028
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 2 Region: 1724-1822
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0000000173
Family Cellulose-binding domain family III 0.019
Further Details:      
 
Domain Number 3 Region: 413-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 4 Region: 105-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000455
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 5 Region: 578-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 4978-5070
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0000017
Family Cellulose-binding domain family III 0.01
Further Details:      
 
Domain Number 7 Region: 3371-3452
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0000248
Family Cellulose-binding domain family III 0.014
Further Details:      
 
Domain Number 8 Region: 3547-3612
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000759
Family Type I dockerin domain 0.0039
Further Details:      
 
Weak hits

Sequence:  PTSG_00638T0
Domain Number - Region: 1904-1970
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000602
Family Type I dockerin domain 0.0081
Further Details:      
 
Domain Number - Region: 211-342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00314
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 5181-5245
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00654
Family Type I dockerin domain 0.0062
Further Details:      
 
Domain Number - Region: 552-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.024
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 390-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0991
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_00638T0
Sequence length 6464
Comment | PTSG_00638 | Salpingoeca rosetta fibropellin III (6465 aa)
Sequence
MAPLTCEERCAVELDACQDTSQCRRSSAQMCLTALMSVVTFDPRPCPSPDECCSTTITDP
DALLIYEAAANCIWENCDADGGGSYTSNVTCACPPGRTGDLCDVDVKECEPNPCQNRGTC
IEGHNGFNCSCVEGFDGPTCGAFVGCDAQENPCQNNGTCSPVFEDAPRCVQQCAAEYLAC
DQDAQCSPRKTCLLIPDGTQGTASLDTVLDCGLPYIMNNASKAIFTTAATCVVEECDLTP
ILEGITCGCPDGYEGDFCETDINECDPDPCLNGGTCTDLIGAFFCACPTGFDGDRCQTRL
NCTTESIANMCQNNATCVSEPRACHRYCEPSIDACAANADCSGPQDATLLCLQAVARAGT
DQCDEACLRDCAQRFSTQAGEALFEDALQCIVDDCPLLPDFRCQCPTGFEGVYCETNPDD
CVEGMCLNGGTCVDGVNTATCTCPASYTGPRCETLLSCEADMCQNNSTCTDLFDVPAAIA
SCSETCDNVFSACLQDDAGALSCSSAFNCLLVPLSDQEHTCELDCVQECGKLQQGTTSRQ
LFDAAAECVFVNCVPNLVPSGFKCTCPAGFTGDLCDEDINECDPNPCSNGGTCLNLLAAY
DCVCPSTTWGDNCQNLCDVCNTTAAAAAAATQYQKQACTPTSNTVCAPLTPCRVGEYEAV
APTPTSDRVCEPIPVARWFPPTTVSVSTPALPASTTGLTRLSATSTRAAFGFLLGGPVDT
PATISASIGPSTASEQVRAAREPASSVTGQLLSPTRVYYDKPYVHAVIQVRDAAQNTRVQ
SNTAVFVEATAPAALRVLQDVSPRQTCVVDSTSGACTVQLALPQAWFAAQAEETVSIAFG
IDGTSNGVLADVVLVPGADRVVLASEVVVELPTHTLFPSKTFTAPIRAKNDIELALYRLS
VDIDQTGLAFDADSPATISDRWLHTVEATPTGIVIVGTLAEENAAPDVDLLATLNLRVLE
TTATTQPDAAQFSINVTVEALGNVRSEPVAVLGRPTPTYATHSHRQQQQGVQFGQVHVQP
NALVTVMPYAGAGDLPNVARLTGQRISHALTVLGAYADGTTAAVSTSSGLLSCSTLNPAT
LKVFADCSAVYFDGDETAGADGTSIAVRVIGLGVLVPVTFRVWLPTAAELTTDAVGPNLQ
AVAGLRHPARSCQPVYQQTQLFCPCTFSTRLLDGSTITRQVDVLPLVLAHLQQTNASVAS
VSDTGVVEGLLPGTTTISLPAPSIVSAATVTVGQGAAVGVRRIDAYPVAGLALSSLPSRV
DRLAAHTVDIGILSNITVEFDTAYVTVRAVLNDTTTLPLDGFPGLNITSLDARVARVLAN
PATPQRFEAVGTGSGDILRVDLSSTEACDAANTVIASGLSPVFISLPQPTALVVHSFKST
LAEANDVVAQLTSSSKRISTSTTLGLRLVFPAYVTDASTDARVVLDTSKSGGLFTAQRRA
SDGRVQVTSNSAGLTGTGTLTIGFSHVSVTHSINITVVGTASVEARLRPWPAYAGSRGVE
VHQLQQYADTGVWQEAVLETVLVLTSGERVDVSTDGAVVSYSVVAGSDVVRVSSGTVVSY
TGAGTAFGNASVEARVAGAVSQFVARADVAATNTSVRVVGFEGLTLAGTVVGVVGHVSRG
QVDVVLSDGRKYADLIDVSGSGSARIGGLVAFSVKGDSSGAVAVDGASGAVTLLGNSAVE
LEYVVRATVGGAMGSRMFAANLQAGDGDVDLGSLSGVPVPAQQPGATFDVPVRLTSTAKV
VAGLRLEVTYPPDVLEYVSATQGSAYGQGLFLVTPNDPPGVLLFGGTTDGVSGSSQEVAV
LRFRVADDAAPPALITLGGTIIELIDDASLDIVAPDTAFVAGNVSMVILDGNLRRRRSAA
GLDVSDSDDVGWSRSLLPVVAPRERHRRAGDAPCTGLPCAGGRHLGDANEDCCFTLADVR
FVQSFLAKRTFDPSFGSDYSRDRYEQMDANINGRVDDFDPVYLIRVLFKQLHFITNVTVT
PVAQSPASGADAAVACQLRISATPLGAGNTVPDPERTFLFFDVESRDTGLRPALDNSAVT
RGQVVVADKGAPTFNGAIFQAEAAVPSGGDDMGDNETPVPHSVDMFTSLDLGDVGLTILQ
VTVDQSSPPQTSDSRAVRISNSTGAVEFGSPFMYQLQLGPATSYTFDLTTPYHPLQLFAN
PTSSLECFVSLPACDTNVFFELDPPTLSSARVCQRVRECNTTTQYETTAPTPTSDRDCAR
IRGPCEPGTFQDAAPTPTSDRVCDNCTVCTSDMYTKTACTILQDTVCANLTACQPGEVEL
VLPTATSDRECGRIPDATLPLATVNSNTGLGYLLEQQLPTVTPAGTRGQVGVFVDALNAD
NGNLRAVLGDSEAQAAFTLQRSPAVSVEAQVATQRLWHDAPQVNVHLVVRDALHSTNTQQ
TQVSIAVTPVDFTSSVPAVTASCTTRSACWARVSVPQEWFSNTTERAVQVTYGLGSTPTQ
QVSSPPLPLSTAPASSPLMATGAAGSGGVWFSAPHRPVRPGATFQVPVYAQGGDYPVNTW
QVRCSVADDADKLVITQMSVDSAWDGQVQGEGTSTVVGNGLPLGDRPELAPEQELLFTLT
VAVQPQDAWTQGANASATTAAEVALSCTVLSLFNVEKQQPLVTPVAAVSSGRDGVRVGDA
SVFLAPAQTVGFAAMIPAAQLVNSAVLTGEAVNSPVSLVAFDEDSTPITVSNNDGDVVAC
ASQDTDVVGVSSDCTRAQLLGVEARGSASAMLTFTWRDLRATAAVAVWYPRLPLFLNITD
TTMNRVSAPGACDAWYQSTRPRVTTVLGLASSNATTTSVDVDVTHLVQLVSSNTTIVGVT
EAFGATTLVGRSAGAVTVVATDASGNGVSNSVAVSAVDSPRAFIANVRSAVVADLSIASV
PATVATGADASAAFAYAVVATQQLTREKQFADVALELVFTDGHTQPLAESQVNLRSLAPG
AIRVYTNTSERTSTTQDIQVLSSIVGEAVEADIVDTSECGRLFGDDNVLLTHTINVDAQL
PLPVDVEVTASARKIASTQDPAGALLATETTLSVALVFADGRKQVMTTDARTRYTVLPAT
GEGMGAQASELLTVAQRSDDTVVALAASPALAGVARVFVNFTHVNVTGEVSVEVVRAQGV
SLAIRPYPSFSGSSQTTVTRLALLANTDVYQQAQLETRVALSDGTSQDVSTHALVEYGAE
ADPANANTTGVLVVGGVSPNRVRVQEDGVAAVSLPFNANVTAVFAGALVATPQPLAVTGE
RTFVTAITDLSFPSTLTGIQNATTATIQAAVTFDDNTQLRRSHLYASGVLQVPGLLSFST
SRPAVASVDASSGVVALHTNFHSAVEYTVHAAGSNGSDVVASDTFFCNLQPVSGDVDLGR
TAGSPLGAQRVGDEFDVDVRVRSDTAFTTLQLNVLFDERALQPISVQQGSQLSGIFSSNI
AIPGTVVIGASVTGLSGTVVVASVRFRALQSGVWAVYGETNTLADASATSLIANPDDPRF
TAGDIQVAVVDNNARRRRSVLHAEAVASPQAQQQQQQQARARRATEVCQPACAVDEWPCA
TCPNGRQFGDANGDCCFDANDVTFVRQLLNQIQGDTSHPAFTSLAPFQQAAADADGNTNV
NTEDAFYMLQVTTFVFSFFTHVQVQPVSAATDCEVLLRTGLLSIGAGRVAEAPAPPNTYV
LFDVESRDTNLRAVLLNANFSAGELVAFKPSPHNGAILRAAYEGDGSYALSFAASHNVSG
MGVSLFQATIAADGVSNLFTGDADRRVTQEFPPFALEFDVGDNSGLHGAVDVQSYNPLVS
VTVNATTEACLPPTKCPSNHYRTSPLGVQPLTCEPYTVCADDEVLVRNGTETTNVECELR
AFFPPYQVASSIDALLFLSAAHNSTTDTNGNSGPNVAAAAATSIASVARAAQLPTFPSAN
RYRTVGFAEQFGTNPFPPALDVHARVGADQEGGDDASAALSVPCTTTERVAPVATIGAVV
LDERSVYEDSAVVRVYCTAFAANGRSGDGVEPVEITAVVTSANSSADAPLPVSATCTASP
ATGGACIAEVAIPSAWFSADSDAMDVDVTVTADAVNATAVYLPSAATIVPTTASLDLSND
AMLVLPQQRLAPGETAAMALNANTGASVGAFAFKVSVSGAMLEVTGAQVSSRFTAQVTQL
APDELGIVGYLPPGSPFVTSEAGTESIASITVRAIDRQRNVQVAGAVALEIVSLASALQQ
SVRPRGEATPTVGLTFDRDGVRAGAGALYIASPQPVAVMARASRYTLWNKLPLAAAGDQN
AAEQTATTIALYNVLADGTLAERDNNDNNDDASNATASTITCTATNGDSVKLDVATCRRL
LFTQNTSAPSPDVVVNMALTGDDSDEQQPVPILNPALRFSVWQMVDGPHVLLDDSVLNTL
PVSLATCSDVSAAPVFQRTRVRVAASFSDGEESTPLADVTTFVHTRIRSTDAAVATVSVS
SVSGDATFIAVYAQGASLGTTDMVLDSALGAGQPTSPVAATAPLRVVADPVNITRLYVSA
TQELALDTASPAACGATSLIEARSKAGLDREGQRAVLSAWMRTSDDQLVDVSAAPFVVFA
SNNTNILDVQGSAAVASAASVGSDSPIAVNALLFPTACTNTSSSAILATGETLVPVFIPQ
PTGIEITLGDAELTLEGDPLTRVQAGSSSSRRPTSTTLGLRLVFPAYVTDASTDARVVLD
TSKSGGLFTAQRRASDGRVQVTTNSAGLTGTGTLTIGFSHVSVTHSINITVVGTASVEAR
LRPWPAYAGSRGVEVHQLQQYADTGVWQEAVLETVLVLTSGERVDVSTDGAVVSYSVVAG
SDVVRVSSGTVVSYTGAGTAFGNASVEARVAGAVSQFVARADVAATNTSVRVVGFEGLTL
AGTVVGVVGHVSRGQVDVVLSDGRKYADLIDVSGSGSARIGGLVAFSVRGDSSGAVAVDG
ASGAVTLLGNSAVELEYVVRATVGGAMGSRMFAANLQAGDGDVDLGSLSGVPVPAQQPGA
TFDVPVRVSAGASVLGALDLDIVYDPTILQAVSIAQTSSLWEGGVFVASLNSPPGVASFG
GLLQKNAAVGVLTVATLRFRVLAPENGANSTSGCITAIHGVVNTIADASSQQLTIGAPTP
RAIVAGSVDVVIGTAASNATTTPCTASTPGRRRRRRDSAVDTTATAVAAAAADGRVARDS
ESLLRARRATPCDPASCPEPRMLGDVLCDCVFDIKDAGALLRFLGRELVDPAVNRSSLSA
DEKRVMDANVNGHIDVLDVSFLAAVNFDLLRFVSAPRVRVLPSPDGCLLEVSVLALTASH
QAASPTDTAIVFDIEPAAGSGDAQRANWTLAEPLAGDLLSPGKPDGYAGAWIQAAVPFAV
APSLYRTVIPLGDTPPTNISGGVSVVQLTVSTEGAFSPDRLLFMTRHVDDAPAYDTALDS
QLANVTFAADSNGQARQGAHVAAAVSKPQGYSPLVGVVQNTSVCDQPGSVDEKPLTTSFL
LPLDYDAIVGNATRLAALEAAVLDGLWRFAGVPPSLVVRITFSRGSVGVDVVHADGRSAD
QTAYAVQQDQMKVNFEGSQVAASPMPSVTTTAGPGTTAPPATGTTTTTITAASTSSTVSL
APPGAEGSTALIVPIVPAVVGGVVLIMLVVLLLVHRRKQRRKRDVELQAHEDALRREQQF
GHIVASPTKDRHSLYLGVATGLDHHEVPMNPLHEDNVQQDVGHYRGLDGAAGRLPSVGRA
MRLPARSTVSPMQSPRGSRAGTSSVSSTPGHSKEQEQQQQKQRGSEAASSFSPLESPTRR
PSAWEFASNREVASGIARLTEGLVYGINRGALQLQRNISGGDSQLDATTDFIDLSGSLPG
DARTDVFDFPSEAGETTTDPRTGGIMLRDGAATTYARLLNPAPQPMYQQQHGQGEEVKYA
ELSLVDTESYTFDVQYLDHRTHVHTEVHRACWKELQETFMSIVHHTVTPQAAFLTLTPEA
LRIKGQPEEPFCSCALTSICECRVETAHVFIGVEDAVDPSLIACHVIRMTDDDSAQRLFG
LLAIACHKRYRELKGSELLRAEPVFSSIAVDPNASLVDTSQVTVDITDDDAWAAPTFDDD
DDDEERHGQQQRDGGSSSDSDTDEDDFDGVIRALRAADELKRREGDQHAAEAQSRQPTQA
FVTSTPVATRGVGLEQHGQFEESSIMSSSRDARLETVMEEDEEDEEEARRAAAERKRQRE
AAYTSSVGTAAEPTRSQHVDSVHAGTAATGSSQQPEDDDDDVWNLDEVAELALATDDMSH
PSVTGAKPGYLDVSPQQQQQQMQHATGDKRGYLDVAPKPGAATTQRPGYLDVTPKAQQKR
GYLDVAPDQQHVRADTSPGYVHVQPQSPATPSSSSTGLQTHVPLYADVSGLHDSRRSEEP
AYINVSVAMPEHHQHQQQRHPDQPSFNRSGDFPFTPEIRPPPGFEQQQQQQQHESTPMAP
SQRAAQHHHHGGGGYGGGHHHRRDMHGEDEEEDMNDLREMLRDM
Download sequence
Identical sequences PTSG_00638T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]