SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00729T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00729T0
Domain Number 1 Region: 493-631
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000439
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 110-232,282-311,362-402
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00000000000837
Family beta-lactamase inhibitor protein-II, BLIP-II 0.031
Further Details:      
 
Domain Number 3 Region: 454-510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000875
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 704-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family EGF-type module 0.037
Further Details:      
 
Domain Number 5 Region: 620-673
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000331
Family EGF-like domain of nidogen-1 0.068
Further Details:      
 
Domain Number 6 Region: 664-700
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000409
Family EGF-like domain of nidogen-1 0.059
Further Details:      
 
Domain Number 7 Region: 742-794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000678
Family EGF-type module 0.008
Further Details:      
 
Weak hits

Sequence:  PTSG_00729T0
Domain Number - Region: 786-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0681
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 796-936
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.0706
Family Fucose-specific lectin 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_00729T0
Sequence length 1156
Comment | PTSG_00729 | Salpingoeca rosetta fibulin-2 (1157 aa)
Sequence
MKSESASLEIDLMSEEGTLMRSRSSKTTGSSSSSPVNAKKYLILGYSAVALVIIICGIAV
GVSLHNSSDPDAASMTQMSATSASLCGIVAPTTEDSSTPVVCYTLHTNTPGGNYRVVSSS
ITHACALSTLDTAVCWGAACDDDHPSCPAELKASKPVWDRSDEQFTAVAVGDYSTCFLRK
ADGTAMCRGRISVPASAAATEFVDITIENDVACGLTATSQLVCWDQDNTVFNIPALSDGI
LQVAASFTPPEPPMITDPFLTSDSSESQRRRRRRRNILEPQPATLAAEDQRIACAISLTH
KLYCINLQPASSTATPTWSRILRSSTAAGFEMVDVYGGRGCALTLAGRIECFELASYVDP
LPAMPAELADVRFGAVDVTQSAACGLSTDNSLYCWGDIWTFGQVKIPKRPLVPSGSSVTA
PPTSGNNTSNATAAPGAFECPSGTRRLRDGSCEDVNECAAGTHACPRFSFCENTYGSYEC
PCFPGYAKESAGSETCVDIDECALDTHDCHVNATCVNWRGSFWCTCNIGFEGTGTECVDI
DECDRDTHNCHEQATCSNTIGSFDCTCNQGWAGNGTYCGDVDECTMGTHNCDANAACSNT
IGGFNCTCNANYYGNGTFCDADQCHFNTHTCDANAYCTDTVPGFNCTCNDGYLGDGFTCA
DYDECTAGTHNCDAHATCSDTVGSFDCTCNVNYLGNGTYCDLDECAAGVDNCHEQATCTN
TDPGFYCTCNAGWDGSGVNCSDVDECDLNTYNCRANSYCNNTIGSYECPCLDYYRDTGPA
CVDIDECGESKDHCPIDVACSNTDGYFSCGCSNQDQSFSYPADVDSFVGLTRASGLPVFL
VSGFNASGYSAHLLWCDDHDCANPTVFESPVLFDEAPHANILSDDTVILAGRRVNSQVLL
YRWCSDVGCTVTGTHQVDDAGYGTRVGVDSNDDIVIMTSSDTELKVMRCDAPECMWGDRL
VNATNKANSPYLDMVLTDQGLPVVTHLESRFLGVFTCVDDLCSNFTGSETLATDDGFMSS
IVLRTDGRAALVWRQQSSGKLMFGLCDDAACSTIQTRELTNGGYFPTIDLMEGDWLYPGQ
YPVITHLKSVTGTRTVQLIKCTSLDCSTKDTTVLQSTGYGGASGVFYNPISHYLYTMDEY
GSQADGWRLSKHCINH
Download sequence
Identical sequences PTSG_00729T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]