SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00739T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00739T0
Domain Number 1 Region: 142-237,308-378
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.51e-17
Family Asparaginyl hydroxylase-like 0.022
Further Details:      
 
Domain Number 2 Region: 743-801
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 666-731,771-787
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000131
Family Growth factor receptor domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_00739T0
Sequence length 1258
Comment | PTSG_00739 | Salpingoeca rosetta predicted protein (1259 aa)
Sequence
MNRQRCPHSTAFLVAFLVLVTAVALALGEPVRPAPDHARSVAVQHLQLADFFSPTATTWT
TTARTTTSPSDSSTPPPLPPLNRTAFFEEVYQHDTLIARDATSARLRSLTRPLGQVQELC
HAFDQQDKQSGGFHIKEQGETRQVSSCKQMEDELAAGAGLLIRYEDLVDSPAQDHVKQLQ
DGVRDVFGTESTVHLYHATQNESRALMPHTDPYDVLVIQLHGSKRWTTCIPDAYVSDTDT
NNDGSDTNKEDDDSTNTGTGDHGASASASASSSSFPSRHGTRARPSEAETIKHFSPAQLG
QLQEIRRQRQQGCTAYQDADLRGMRCNEFTLRAGDTMYMPKGIIHFALSGEEGSSHLTIS
LERKGLAWADALMHAALSGSDIVNNPAFLGHWKNTVQSLISDYRGVQLLEAMPSWHLNTG
ALCAARGQEQQQQQQQQQQQQQHGDGSAAGGERDEAKAFVASFQSLCREVGPDVLETYTK
ANNVDAFLNADGIGALVERVCSEESAAAVVEQLCARGKMPVDVTSPRFHKAALAVSNHAP
AAMTRVTPSVMTRARAATQAATFATANHAAAVIWLATQGVTQAAMGVTSTNATLGATPVA
ELCGGTASAAAMKTVDGRAVITVVMTLVTPAARKAAITASRRIAPAAAMTLAMDHATRKH
LVFGGCDGSCNTGCDQCVGISCDDSCDGTCSCNPGFYGNGTSCTACPSSKYSASSNQTTC
SPCASCPVGKYRFGCGGSSPGSCLGVACSSPVIEHAVLSVNSTRYPATAIVSCEEGYKLI
GASSLTCRADGSWGKLPSCLSLGATPTSSAASSASAEPMTTTTLTSTTMIVVPAGSFDLQ
YPDDKPAFRVVFSKVKVIIGDIEYAACSVGSSDKDCSQGEFVISSKASDERMVQVTWRPT
DPRQTQRLNGLVFHLSGGSISVVTVLNSFPNVSAMPGLHQLLRAASLALHNVKSSHLQLQ
HKQQQQQQQQQLKQQQQQQQQQQLLQQQQQQQLKQQLLQQQQPQQQQLLQQQQHQQQQQQ
HLQQQQQQQQQQQQQLKQQLLQQQQPQQQQQQQLKQQLLQQQQPQQQQQPQQQQLLQQQQ
HQQQQQHLQQQQQQQQQPISPRALQIRAKLATQAILTPVDLSRIPCVRVLELQQQHQQQH
QADVRGPRTGLSLYENPTFGVGDAGTDESDEAGAPTYDTIEFAGSDPDYDNLEPEHTLAS
TIGLGLPPPIHAPRASSPDPVYEEVCDHLASGSRAVSVSEPGARPKHVWSTNDYDMTG
Download sequence
Identical sequences PTSG_00739T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]